SecReT6
Protein ID: 549722987
SecReT6 ID857
T6SS typei3
Gene symbolsciE
Locus tagSTMDT2_02651
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. DT2
Repliconchromosome [GenBank: NC_022544] [Browse all T6SS(s) in this replicon]
Location [Strand]309102..309926 [-]
Productvirulence associated protein
NoteTagJ
UniProt IDU4MDG1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.10E-46, Aligned region: 143..266
Protein Sequence: 274 a.a.     [Download]
>gi|549722987|ref|YP_008643177.1| virulence associated protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT2]
MKKTDTLPATLSALIQEYSIAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWSRALHQLQLCARMEAN
YTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGG
QWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWL
FTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA
 
Nucleotide Sequence: 825 bp     [Download]
>gi|549722728|ref|NC_022544.1|:c309926-309102 Salmonella enterica subsp. enterica serovar Typhimurium str. DT2, complete genome
ATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGATACAGGAATACTCTATTGCGGAGGGGA
TTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAAGCGCTCTGCCGCCACAGCCTGTTTCAGTT
GCTGTGTGTGGCCGGAGACTGGTCGCGGGCGCTACACCAGCTTCAGCTATGCGCCAGGATGGAGGCCAAT
TATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTCGCTGCGAAATGTTCCGCCACACCGTTTTTCAGG
GTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCTGGCGGCACTCGCCTG
TCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATAACAGACACGGGCGGG
CAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCCCGGTACTTGAGCTAG
TCACCGGCGGCGTGTATATCTGGCTGCCGTTTTCGCAAATACGCTCGCTGGAATCGCCGCAACCGACGCG
CCTGACTGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACGCACGGCGCCTGGCTC
TTTACCCGTTACAGCGGTTCGGAAAGTGCATCCGACGCCCTGCGTCTGTGCAGGGAAACCGCCTGGCAGG
ACGGCCCCGGCGAAACCACCGTGCGGGCGCTGGGGCAGAAAGTGTGGCTGACCAGCCACGGCGATATCAG
CCTGCTGGACATGGCCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA