SecReT6
Protein ID: 549722990
SecReT6 ID857
T6SS typei3
Gene symbolsciH
Locus tagSTMDT2_02681
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. DT2
Repliconchromosome [GenBank: NC_022544] [Browse all T6SS(s) in this replicon]
Location [Strand]313922..314464 [+]
Productvirulence associated protein
NoteTssB
UniProt IDU4M9E3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.70E-60, Aligned region: 11..164
Protein Sequence: 180 a.a.     [Download]
>gi|549722990|ref|YP_008643180.1| virulence associated protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT2]
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKSAATQQDVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|549722728|ref|NC_022544.1|:313922-314464 Salmonella enterica subsp. enterica serovar Typhimurium str. DT2, complete genome
ATGGCTATCAACAATAGCGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGTTCCGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGCATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCTGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACGCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACTCAACTGGCGAACCTCCAGACCTACATGGATGGCAAGGCG
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACTCTGCTGAAAACGCTGGCGAATGCGCCGA
AATCGGCCGCTACCCAGCAAGATGTGTCAGCGGATAATGAATCAGCGGAATAA