SecReT6
Protein ID: 549722998
SecReT6 ID857
T6SS typei3
Gene symbolsciN
Locus tagSTMDT2_02761
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. DT2
Repliconchromosome [GenBank: NC_022544] [Browse all T6SS(s) in this replicon]
Location [Strand]319205..319741 [+]
Producthypothetical protein
NoteTssJ
UniProt IDU4MHF8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-41, Aligned region: 20..170
Protein Sequence: 178 a.a.     [Download]
>gi|549722998|ref|YP_008643188.1| sciN [Salmonella enterica subsp. enterica serovar Typhimurium str. DT2]
MNEWRNPTRWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKN
DAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYK
IPEAPEKAWYSSFISGKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|549722728|ref|NC_022544.1|:319205-319741 Salmonella enterica subsp. enterica serovar Typhimurium str. DT2, complete genome
GTGAATGAATGGCGTAACCCCACTCGGTGGTTATGTGCGGTAGCTATGCCTTTTGCACTGCTCCTGCTTT
CCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGCGACTCGACCTGAGCGTGAAAGCCTC
CGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGAGATACGTGTTTATGAACTGAAAAAT
GACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAACGACAAATCCGTCCTTACCGACGATT
TAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAAAACTGCGTCGCCCGCTGAATGCGCA
GACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAAATCGGTCTGGCGGGTAACCTACAAA
ATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCATATCGGGGAAAGGAAAAGTGCAGTTGGAGG
CGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAATGA