SecReT6
Protein ID: 549723009
SecReT6 ID857
T6SS typei3
Gene symbol-
Locus tagSTMDT2_02862
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. DT2
Repliconchromosome [GenBank: NC_022544] [Browse all T6SS(s) in this replicon]
Location [Strand]332519..336619 [+]
Producthypothetical protein
NotePAAR
UniProt IDU4MA38
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 392..427
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 412..447
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 476..494
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 520..557
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 584..621
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 626..662
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 668..698
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 710..746
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 753..787
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 799..828
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 844..865
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 850..885
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 891..922
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 983..1000
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 991..1019
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 1034..1053
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 1058..1091
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 1121..1128
RHS_repeat [PF05593], Evalue: 7.60E-47, Aligned region: 1145..1167
PAAR_motif [PF05488], Evalue: 2.50E-15, Aligned region: 73..142
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 551..568
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 578..596
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 868..886
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1042..1052
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1147..1179
Protein Sequence: 1366 a.a.     [Download]
>gi|549723009|ref|YP_008643199.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Typhimurium str. DT2]
MTMYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLAGLILGFMADQIASGVLQLGEAIG
RSIHHTAGKILTGSENVSTNSRPAARAVLSTVKCDNHIAEKRIAQGSENIYINSQPAARKDDHTECDAVI
EDGSPNVFLGGGTQTVLEISSEIPDWLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGE
LVGMAVGEAISGLFSNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGRGWRLNWETSLR
DDDEHITLTGVQGRELRYPKTMLTPGHQIFDPEEQLYLSRLHDGRYVLHYTDRSYYVFGDFDSDGMAYLL
FMETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQGGTRGNLVEYRYDDNGQLTG
VVNRAGTQVRQFAYENGLMTAHSNATGFTCRYRWQELDGAPRVTEHDTSDGEHYRFDYDFAAGTTTVTGR
QGETWQWWYDRETYITAHRTPGGGMYRFTYNEDHFPVNIELPGGRTVAYEYDIQNRVVKTTDPEGRVTQT
QWNGEFDEITRTALDDDAVWKTQYNAHGQPVQETDPEGRVTQYAYDEQGQMCSRTDAAGGTVVTAFDSRG
QMTRYTDCSGRSTGYDHDEDGNLTRVTDAEGKVVRISYNRLGLPETVNSPGKQQDRYTWNALGLMSSHRR
ITGSVESWRYTPRGLLAAHTDEEKRETRWQYTPEGRVAALTNGNGAQYRFSHDADGRLVREVRPDGLSRT
FILDDSGYLTAIQTTGTQGGVRRETQQRDALGRLLRTENEHGQRTFSYNRLDQITAVTLTPTEAGQQQHR
MQADTVRFEYDRSGWLTAEHAGNGSICYQRDALGNPTDITLPDGQHLTHLYYGSGHLLQTALDGLTVSEY
ERDSLHRQIMRTQGQLATYSGYDDDGLLSWQRSLASGSAPVLPGQRPARQGCVTSRDYYWNNHGKVGTID
DGLRGSVVYSYDRSGYLTGRSGQMYDHDRYYYDKAGNLLDNEGQGAVMSNRLPGCGRDRYGYNEWGELTT
RRDQQLEWNAQGQLTRVISGNTETHYGYDALGRRTRKATYGRHTGHTARSRTDFVWEGFRLLQENVQQQG
WRTYLYDAEQPYTPVASVTGRGESRQVWYYHTDVTGTPQEVTAADGTLVWAGYIRGFGENAADISNSGAY
FHQPLRLPGQYFDDETGLHYNLFRYYAPECGRFVSQDPIGLRGGLNLYQYAPNPLKYIDPLGLTATVGRW
MGPAEYQQMLDTGTVVQSSTGTTHVAYPADIDAFGKQAKNGAMYVEFDVPEKSLVPTNEGWAKIVGPDSI
EGRLAKRKGLPVPEMPTAENITVRGEKINGEVEAKC
 
Nucleotide Sequence: 4101 bp     [Download]
>gi|549722728|ref|NC_022544.1|:332519-336619 Salmonella enterica subsp. enterica serovar Typhimurium str. DT2, complete genome
GTGACCATGTATGAAGCAGCCCGTGTGGATGATCCTATCTACCACACCAGCGCGCTCGCCGGGTTTCTTA
TCGGCGCTATCATCGGCATCGCCATTATCGCGCTTGCCGCCTTTGCCTTCTTTAGCTGCGGTTTTCTTGC
CGGGCTGATTCTGGGTTTTATGGCCGATCAAATAGCCTCCGGGGTATTGCAACTGGGCGAGGCCATCGGG
CGCTCCATCCACCACACGGCAGGAAAAATCCTCACCGGTTCGGAGAATGTCAGCACCAACAGTCGCCCGG
CGGCGCGCGCGGTACTGAGTACGGTGAAATGCGATAACCATATCGCAGAAAAACGCATCGCCCAAGGGTC
GGAAAATATCTACATCAACAGCCAGCCCGCCGCCCGTAAGGATGACCACACCGAATGCGACGCGGTGATT
GAAGACGGTTCGCCGAATGTGTTTCTCGGCGGCGGCACACAGACGGTACTGGAAATCAGTTCTGAAATTC
CGGACTGGCTGCGCAAGGTGGTGGATGTATTGTTTGTCGTGGCGAGTCTGCTCGGCGGGCTGGCCGGGGC
GTGGCGGCAGGCGGCAAAGCTGGGGACGAAATTTGGCACTAAATGTGCCGCTAAGTTTATCGGCGGGGAG
CTTGTCGGGATGGCCGTGGGTGAGGCTATCAGCGGGCTGTTCAGCAATCCGGTGGATGTGACCACCGGGC
AGAAAATCCTGCTGCCGGAAACGGACTTCACCCTGCCCGGTCGCCTGCCGGTCACCTGCTCGCGTTTTTA
CGCCAGCCACCTGGAAACTGTGGGACTGTTGGGACGGGGCTGGCGGCTGAACTGGGAAACCAGCCTGCGC
GATGACGATGAACACATCACGCTGACCGGCGTACAGGGGCGGGAACTGCGTTACCCGAAAACGATGCTGA
CGCCCGGCCACCAGATATTTGACCCGGAAGAACAGTTATACCTCAGCCGCCTGCATGACGGGCGTTACGT
GCTGCATTACACCGATCGCAGCTATTACGTATTTGGTGATTTTGACAGTGACGGCATGGCATACCTGCTG
TTTATGGAGACGCCGCACCGCCAGCGCATTGTCTTCGGGCACGAAGGAGGCAGACTGGTACGGATAGCCT
CCAGCAGCGGGCATCACCTGTTACTGCACCGCACACAGACCCCGGCAGGGGAGCGGCTGTCGCGAATTGA
ACTGGTGCAGGGCGGCACCCGTGGCAATCTGGTGGAGTACCGGTATGACGATAACGGTCAACTGACCGGC
GTGGTGAACCGGGCGGGAACGCAGGTGCGTCAGTTTGCTTATGAAAACGGGCTGATGACGGCGCACAGCA
ATGCGACGGGGTTCACCTGCCGCTACCGCTGGCAGGAACTCGACGGCGCGCCGCGCGTGACGGAGCACGA
CACCAGTGACGGCGAACATTACCGCTTTGACTATGATTTTGCCGCAGGCACCACCACCGTCACCGGCAGG
CAGGGGGAGACATGGCAGTGGTGGTACGACAGGGAAACGTATATCACCGCGCACCGGACGCCGGGCGGTG
GAATGTACCGCTTCACGTACAACGAAGACCACTTCCCTGTCAACATTGAGCTGCCCGGCGGTCGCACGGT
GGCGTATGAATATGACATCCAGAACCGGGTGGTGAAGACGACAGATCCGGAAGGCCGGGTGACGCAGACG
CAGTGGAACGGCGAGTTCGACGAAATCACGCGCACGGCGCTGGACGATGACGCTGTCTGGAAAACGCAGT
ACAACGCCCACGGCCAGCCAGTGCAGGAGACGGACCCGGAAGGGCGGGTGACGCAGTACGCTTACGATGA
ACAGGGGCAGATGTGCAGCCGGACGGATGCGGCGGGCGGCACGGTGGTGACGGCGTTCGACAGCCGGGGG
CAGATGACGCGGTACACCGACTGTTCAGGGCGCAGCACAGGATATGACCACGATGAGGACGGCAACCTGA
CGCGGGTGACGGACGCGGAAGGGAAGGTGGTACGCATCAGCTACAACCGACTTGGGTTGCCGGAGACGGT
AAACTCACCGGGGAAACAGCAGGACAGGTATACCTGGAATGCGCTGGGGCTGATGAGCAGCCACCGGCGC
ATCACGGGGAGCGTGGAGAGCTGGCGGTATACGCCGCGCGGTCTGCTGGCGGCGCACACGGATGAGGAGA
AGCGCGAGACGCGCTGGCAGTACACGCCGGAAGGCCGGGTGGCAGCGCTGACCAACGGCAACGGGGCGCA
GTACCGGTTCAGTCACGATGCGGACGGCAGGCTGGTGCGTGAGGTTCGCCCGGACGGACTGAGCCGTACT
TTTATCCTGGACGACAGCGGTTATCTGACGGCGATACAGACCACGGGCACGCAGGGCGGCGTGCGGCGGG
AGACGCAGCAGCGGGATGCGCTGGGCCGTCTGTTACGGACGGAGAATGAACACGGCCAGCGGACGTTCAG
CTACAACCGGCTGGACCAGATAACGGCAGTGACGCTCACGCCCACGGAGGCGGGACAACAGCAGCACCGG
ATGCAGGCCGACACGGTGCGTTTTGAGTATGACCGCAGCGGCTGGCTGACGGCGGAGCACGCGGGGAACG
GTAGCATATGTTATCAGCGCGACGCGCTGGGCAACCCGACGGACATCACGCTGCCGGACGGGCAGCACCT
GACGCATCTGTATTACGGGAGCGGGCATCTGTTACAGACGGCGCTGGACGGCCTGACGGTGAGCGAGTAT
GAGCGCGACAGCCTGCACCGTCAGATAATGCGCACGCAGGGGCAGCTTGCGACGTACAGCGGCTATGACG
ACGACGGGCTGCTGAGCTGGCAGCGCAGTCTGGCGTCCGGCAGTGCCCCTGTTCTTCCTGGCCAGCGCCC
GGCGCGGCAGGGCTGCGTGACGTCGAGGGACTATTACTGGAACAACCACGGCAAGGTGGGCACGATTGAC
GACGGCCTGCGTGGCAGCGTGGTGTACAGCTATGACAGAAGCGGTTACCTGACCGGGCGCTCAGGTCAGA
TGTATGACCATGACCGTTATTATTACGATAAGGCGGGCAACCTGCTGGATAACGAAGGGCAGGGAGCGGT
GATGAGCAACCGGCTGCCGGGCTGTGGTCGTGACCGTTACGGCTATAACGAGTGGGGCGAGCTGACCACG
CGGCGCGACCAGCAACTGGAGTGGAACGCGCAGGGGCAGCTGACGCGGGTCATCAGCGGCAACACGGAGA
CGCACTACGGCTACGATGCGCTGGGGAGGCGAACCCGCAAGGCGACGTACGGGCGGCACACGGGCCATAC
GGCGCGGAGCCGGACGGACTTTGTGTGGGAGGGGTTCAGGCTGTTGCAGGAGAACGTGCAGCAGCAGGGC
TGGCGGACCTATCTGTACGATGCGGAACAGCCGTACACGCCGGTGGCGAGCGTGACGGGGCGGGGAGAAA
GCAGGCAGGTGTGGTATTACCACACGGATGTGACGGGCACGCCGCAGGAGGTGACGGCGGCGGACGGAAC
GCTGGTGTGGGCGGGGTATATCAGGGGGTTTGGAGAGAATGCGGCGGACATCAGCAACAGCGGGGCGTAC
TTTCACCAGCCGCTGCGGCTGCCGGGGCAGTATTTTGACGACGAGACAGGGCTGCATTACAATCTGTTCA
GATATTATGCACCGGAGTGTGGACGGTTTGTCAGTCAGGATCCGATCGGGCTGAGGGGCGGGTTAAACCT
TTATCAGTATGCGCCAAATCCTCTCAAATATATAGACCCACTTGGTTTAACCGCGACTGTTGGGCGATGG
ATGGGGCCTGCGGAATATCAGCAAATGCTTGATACTGGGACAGTAGTACAAAGTTCAACAGGGACAACTC
ATGTTGCCTACCCTGCTGATATAGATGCTTTTGGTAAGCAAGCAAAAAATGGTGCTATGTATGTTGAATT
TGATGTGCCTGAAAAATCATTAGTACCTACAAATGAAGGATGGGCAAAAATAGTAGGGCCAGATTCTATC
GAAGGGCGATTAGCTAAACGCAAAGGTTTGCCTGTTCCTGAAATGCCAACAGCAGAAAACATAACTGTAA
GGGGCGAGAAAATTAATGGGGAAGTTGAAGCAAAATGCTAA