SecReT6
Protein ID: 550444338
SecReT6 ID858
T6SS typei2
Gene symbol-
Locus tagD364_06875
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]1455722..1456213 [+]
Producthypothetical protein
NoteTssB
UniProt IDU5MAI9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.20E-53, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|550444338|ref|YP_008659916.1| hypothetical protein D364_06875 [Klebsiella pneumoniae CG43]
MADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKENRPLSEREKINVNKNNFNSVLSEF
SPEVNLSVPNTLAGNGEEENVRLRFTDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EAILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|550443072|ref|NC_022566.1|:1455722-1456213 Klebsiella pneumoniae CG43, complete genome
ATGGCTGATACGTTCCAGAATGAAGTCCCCAGGGCGCGCATTAATCTCAAATTATCTCTTCATACCGGCG
GCGCGCAAAAGAAGGTCGAACTGCCGCTGAAGCTGCTTACCATTGGCGATTTTAGTCATGGTAAGGAAAA
CCGGCCTTTATCGGAAAGAGAAAAAATCAACGTCAATAAAAATAATTTTAACAGCGTACTTTCGGAATTT
AGCCCGGAAGTTAACCTCTCGGTGCCGAATACGCTGGCCGGCAATGGCGAAGAGGAGAACGTCAGACTGC
GTTTTACCGACATCAAAGATTTTGAACCGGAGCAGGTTGCCCGGCAAATTCCGCAACTCCGTGCCATGCT
GGCGATGCGTAATTTATTACGCGATCTCAAATCCAATCTGCTCGATAACGCCACTTTCAGAAAAGAGCTT
GAGGCAATCCTGAAAGATCCGGCGCTGTCCCAGGAATTACGCGACGAAATGAGTGCGCTTGCCCCGAAAT
AA