SecReT6
Protein ID: 550444339
SecReT6 ID858
T6SS typei2
Gene symbol-
Locus tagD364_06880
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]1456256..1457800 [+]
ProductEvpB/family type VI secretion protein
NoteTssC
UniProt IDU5M9P8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-171, Aligned region: 88..510
Protein Sequence: 514 a.a.     [Download]
>gi|550444339|ref|YP_008659917.1| EvpB/family type VI secretion protein [Klebsiella pneumoniae CG43]
MSVTTENAPVQGQTTLQENRAGEGVYASLFEKINLAPASRLGDINDFLDDAALSEAPAAERLTAAMQVFM
ERIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWRGLKQLVDNTDYRQNVKTEIL
DVAKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISRVSAAAHM
PFIGAVGPAFFLKETMEEVAAIKDIGNYFDRAEYIRWKAFRETDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPDHEKYLWTSAAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|550443072|ref|NC_022566.1|:1456256-1457800 Klebsiella pneumoniae CG43, complete genome
ATGTCTGTTACCACAGAAAACGCCCCTGTTCAGGGGCAAACCACGCTGCAGGAAAACAGGGCGGGCGAGG
GCGTTTACGCCTCGCTGTTTGAAAAAATTAATCTCGCCCCGGCGTCTCGCCTCGGGGATATCAACGACTT
TCTGGACGATGCCGCGCTCTCCGAGGCGCCGGCGGCGGAACGTCTCACCGCGGCGATGCAGGTGTTTATG
GAACGCATCCGTCAGTCCGGCCAGCGGGTGGAAAAGCTCGACAAAACGCTGATCGACCACCATATCGCCG
AGCTGGATTTCCAGATAAGCCGTCAGCTGGACGCGGTGATGCACCATCAGGAGTTTCAGCAGGTCGAATC
CCTGTGGCGCGGCCTCAAACAGCTGGTGGACAACACCGACTATCGGCAGAACGTCAAAACGGAGATCCTC
GACGTCGCCAAAGACGATCTGCGCCAGGACTTTGAGGACGCGCCGGAGCTTATCCAGAGCGGCCTCTACT
GGCACACCTATACCGCGGAGTATGACACTCCCGGCGGCGAGCCGATCGGCTCGGTGATCTCGGCCTATGA
GTTCGACGCCAGCCCGCAGGATGTGGCGCTGCTGCGCAATATCTCCCGCGTCTCTGCGGCCGCCCATATG
CCGTTTATCGGCGCCGTCGGCCCGGCCTTCTTCCTGAAAGAGACCATGGAAGAGGTGGCTGCCATTAAGG
ATATCGGCAACTACTTCGATCGTGCGGAATATATCCGCTGGAAGGCGTTTCGCGAAACTGACGATGCCCG
CTACATCGGTCTGGTGATGCCGCGCGTGCTGGGTCGTCTGCCGTACGGTCCGGACACCGTGCCGGTGCGC
AGCTTCAACTATGTCGAGCAGGTGAAAGGTCCGGACCACGAAAAGTATCTCTGGACCAGCGCGGCGTTCT
CCTTCGCTTCCAATATGGTGAAGAGCTTTGTCAATAACGGCTGGTGCGTGCAAATTCGCGGTCCGCAGGC
CGGCGGCGCGGTGAAAGATCTGCCCATCCATCTGTACGATCTGGGCACCGGCAACCAGGTGAAGATCCCT
TCCGAGGTGATGATCCCGGAAACGCGGGAGTTTGAGTTCGCCAGCCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAATCGCGATTACGCCTGCTTCTTCTCGGCCAACTCCGCGCAGAAACCGGCGCTGTACGATACCGC
CGACGCCACCGCCAACAGCCGTATCAACGCGCGTCTGCCTTATATCTTCCTGCTGTCGCGCATCGCGCAC
TACCTGAAGATGATCCAGCGCGAGAATATTGGCACCACCAAGGACCGGCGTCTGCTGGAGCTGGAGCTGA
ACACCTGGGTGCGGAGCCTGGTGACCGAAATGACCGACCCCGGCGACGAGCTGCAGGCCTCCCATCCGCT
GCGCGATGCCAGCGTGGTGGTGGAAGATATCGAGGATAACCCGGGCTTCTTCCGCGTGAAGCTGTACGCG
GTGCCGCACTTCCAGGTCGAGGGGATGGACGTCAATCTGTCGCTGGTTAGCCAGATGCCAAAGGCGAAGG
CGTAG