SecReT6
Protein ID: 550444340
SecReT6 ID858
T6SS typei2
Gene symbol-
Locus tagD364_06885
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]1457810..1459153 [+]
Producthypothetical protein
NoteTssK
UniProt IDU5MAE5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.00E-136, Aligned region: 19..444
Protein Sequence: 447 a.a.     [Download]
>gi|550444340|ref|YP_008659918.1| hypothetical protein D364_06885 [Klebsiella pneumoniae CG43]
MMKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARMGLNHPWGVVEATFEPEMLKLGRLQAHRLQVRFQ
DGTMIDTDNADALPSALSLDGASGEAVIVLALPLMQANGGNCLKPEEVAERPARFRQRWRDVRNQFGDDT
RQIAVIQPELILRFAHQDNSDYLTCPLVRLQRDSQGAWLIDETFLPPLLQIQGSRWLATQLEQLLIQLRA
RLTRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGYFLRYRQSPPERLYPELARLAGSLLTFSL
THQANAVPIYQHDQLNAVFPPLFDLLSDLLEASLPSRVVAIALEHDVRLHFWQARLHDARLREGADYYLS
VRSSVPVAQLQEQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEM
LQSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|550443072|ref|NC_022566.1|:1457810-1459153 Klebsiella pneumoniae CG43, complete genome
ATGATGAAAACGGAACGTCCGTTGTGGGGCCGGGGCATTATGGTGTCGCCTCAGCATTTTCAACAGCAGG
CTGCGTATGCAGCCTGGACTGCGGAAGTGATTGCCCGGATGGGTCTTAACCACCCCTGGGGAGTGGTTGA
GGCGACCTTCGAACCAGAGATGCTCAAACTGGGCCGCCTGCAGGCTCACAGGCTGCAGGTCCGGTTCCAG
GATGGCACGATGATTGATACGGACAATGCCGATGCGCTGCCGTCCGCGCTGTCGCTGGACGGCGCGTCCG
GCGAGGCGGTAATCGTGCTGGCGCTGCCCCTGATGCAGGCGAATGGCGGCAACTGTCTGAAGCCGGAGGA
GGTGGCCGAAAGGCCGGCGCGCTTCCGCCAGCGCTGGCGCGATGTCCGTAACCAGTTTGGGGATGATACC
CGGCAGATTGCCGTCATACAGCCGGAGCTGATCCTCCGCTTCGCCCACCAGGACAACAGCGATTACCTGA
CCTGTCCGCTTGTTCGCCTGCAGCGGGACTCGCAGGGGGCCTGGCTTATCGACGAGACGTTTCTCCCGCC
GCTGCTGCAGATCCAGGGCAGCCGCTGGCTGGCGACGCAGCTTGAACAGCTGCTCATCCAGCTCCGGGCT
CGTCTGACGCGCCTGATGGCCATGCGTCGCGAAAGCAATGAACGGATGGCTGATTTTGCCGTAGCCGATG
TCTCTCTGTTCTGGTTGCTGAATGCGCTGAACAGCGCCGAGCCGGTGCTGGGGTACTTTCTGCGTTACCG
GCAAAGCCCGCCGGAACGCCTCTACCCGGAGCTGGCGCGCCTGGCTGGTAGCCTGCTGACCTTTTCGCTC
ACCCATCAGGCGAATGCCGTCCCGATCTATCAGCATGACCAGCTGAACGCGGTTTTTCCGCCGCTGTTTG
ATTTACTGAGCGACCTGCTGGAGGCGAGCCTGCCATCGCGCGTGGTGGCGATTGCCCTGGAGCATGATGT
CCGGCTGCACTTCTGGCAGGCGCGTCTGCACGATGCCCGGCTGCGGGAAGGGGCTGATTACTACCTGTCG
GTTCGTTCGTCGGTACCGGTCGCCCAACTGCAGGAGCAGTTTCCGCGCCAGTGCAAAGTGGGCAGTCCGG
ATCATGTCAAAGCCATCGTCAACTCCTCGCGGACAGGGGTGCCCCTCACGCCATTGCGTCATGTGCCGGC
GGCGATCCCGCTGCGTCTGGAAAATCAGTATTTCAGCCTCGATGTGTCCCACCCTCTGGCGACGGAAATG
CTGCAGAGCGGCACCTGTATGTTTTACGTGCCGGGGATGCTCGGTGAGCCTGAACTTGAACTTTTTGCGG
TACTACGAACGTGA