SecReT6
Protein ID: 550444341
SecReT6 ID858
T6SS typei2
Gene symbol-
Locus tagD364_06890
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]1459150..1459839 [+]
Productmembrane protein
NoteTssL
UniProt IDU5MD35
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.40E-38, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|550444341|ref|YP_008659919.1| membrane protein [Klebsiella pneumoniae CG43]
MNEPKRGNAASIDIDALLQNTWLQVISLRHGPQFRNEEGYTLWQRCIADVERVQHELKASGLDDASCQHI
LTAQCALLDEAVKGRGVEDEACLQWYDIPLQGHFLGTMDAGDTLCERMRDVLREPAPNLAVVTCFQRVML
LGFIGSFRSLHDPERLKLVNALGERVPPFQCPATAPVLVESRAGLGISGWLAPWPVRIGLSVVVVLALWW
GLNHWLDHLLLTLLPGEVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|550443072|ref|NC_022566.1|:1459150-1459839 Klebsiella pneumoniae CG43, complete genome
GTGAATGAGCCTAAACGCGGCAACGCCGCGTCCATTGATATTGATGCGCTGCTGCAGAACACCTGGCTGC
AGGTTATCAGCCTGCGCCACGGCCCGCAGTTCCGCAATGAGGAAGGGTACACGCTATGGCAGCGCTGTAT
TGCTGATGTCGAGCGCGTGCAACATGAGCTGAAGGCGAGCGGGCTTGATGACGCCAGCTGTCAGCATATT
CTCACCGCCCAGTGCGCGCTGCTCGATGAAGCCGTGAAAGGGCGCGGCGTGGAGGATGAGGCCTGCCTGC
AGTGGTATGACATTCCGCTGCAGGGGCACTTCCTCGGCACCATGGACGCCGGCGACACCCTGTGCGAGCG
GATGCGTGATGTGTTGCGTGAACCGGCGCCCAACCTGGCCGTGGTCACCTGTTTTCAGCGGGTGATGCTG
CTGGGTTTTATTGGCAGCTTTCGCTCCCTCCACGACCCCGAGCGCCTGAAGCTGGTCAACGCGCTCGGTG
AGCGTGTTCCTCCTTTTCAGTGCCCGGCTACCGCTCCCGTACTGGTAGAGAGTCGCGCCGGTCTGGGGAT
AAGCGGCTGGCTGGCCCCATGGCCGGTACGTATTGGCCTGAGCGTGGTGGTGGTACTCGCCCTGTGGTGG
GGACTCAACCACTGGCTCGATCACCTGCTGCTGACCTTGTTACCGGGGGAGGTGAAATGA