SecReT6
Protein ID: 550444343
SecReT6 ID858
T6SS typei2
Gene symbol-
Locus tagD364_06900
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]1461547..1462038 [+]
ProductHcp family type VI secretion system effector
NoteTssD
UniProt IDU5MAJ2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|550444343|ref|YP_008659921.1| Hcp family type VI secretion system effector [Klebsiella pneumoniae CG43]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHDIKNPAYEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|550443072|ref|NC_022566.1|:1461547-1462038 Klebsiella pneumoniae CG43, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGCGCGGACATTAAAGGGTCTGTCGACGTTC
AGGATCGTGAAGGCAGTATCGAAGTGGTGGCCCAGGAGCATAACCTGTACATCCCGACCGATAACAACAC
CGGCAAACTGACCGGCACGCGTATTCATACGCCGTTCCTGTTCACCAAGGAGATCGACTCCTCCAGCCCC
TACCTGTACAAGGCAGTGACCACCGGCCAGACCCTGAAATCCGCTGAGTTCAAGTGGTACCGAATCAACG
ATGCCGGCCAGGAAGTGGAGTATTTCAATACCAAACTTGAGAACGTCAAGGTGGTGAAAGTGAATCCCCT
GATGCACGACATCAAAAACCCCGCCTACGAGAAGCACAACCATCTGGAACAGATTGAGCTGCGCTACGAG
AAGATCACCTGGACCTATAAAGACGGCAACATCATTCACTCCGATAGCTGGAACGAACGCGCCACCGCGT
AA