SecReT6
Protein ID: 550444344
SecReT6 ID858
T6SS typei2
Gene symbol-
Locus tagD364_06905
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]1462304..1464958 [+]
ProductATPase
NoteTssH
UniProt IDU5M9Q2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 236..255
AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 610..775
AAA [PF00004], Evalue: 2.60E-20, Aligned region: 238..350
AAA [PF00004], Evalue: 2.60E-20, Aligned region: 615..736
AAA_5 [PF07728], Evalue: 8.70E-15, Aligned region: 238..258
AAA_5 [PF07728], Evalue: 8.70E-15, Aligned region: 614..734
AAA_16 [PF13191], Evalue: 8.10E-14, Aligned region: 139..158
AAA_16 [PF13191], Evalue: 8.10E-14, Aligned region: 215..260
AAA_16 [PF13191], Evalue: 8.10E-14, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 8.10E-14, Aligned region: 451..511
AAA_16 [PF13191], Evalue: 8.10E-14, Aligned region: 585..651
AAA_16 [PF13191], Evalue: 8.10E-14, Aligned region: 678..709
AAA_16 [PF13191], Evalue: 8.10E-14, Aligned region: 754..799
ClpB_D2-small [PF10431], Evalue: 3.40E-13, Aligned region: 383..406
ClpB_D2-small [PF10431], Evalue: 3.40E-13, Aligned region: 784..855
AAA_22 [PF13401], Evalue: 3.00E-09, Aligned region: 137..149
AAA_22 [PF13401], Evalue: 3.00E-09, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 3.00E-09, Aligned region: 611..649
AAA_25 [PF13481], Evalue: 5.00E-09, Aligned region: 238..312
AAA_25 [PF13481], Evalue: 5.00E-09, Aligned region: 610..643
AAA_19 [PF13245], Evalue: 3.70E-08, Aligned region: 235..260
AAA_19 [PF13245], Evalue: 3.70E-08, Aligned region: 610..636
Arch_ATPase [PF01637], Evalue: 8.00E-07, Aligned region: 216..253
Arch_ATPase [PF01637], Evalue: 8.00E-07, Aligned region: 290..387
Arch_ATPase [PF01637], Evalue: 8.00E-07, Aligned region: 607..629
Arch_ATPase [PF01637], Evalue: 8.00E-07, Aligned region: 684..696
IstB_IS21 [PF01695], Evalue: 2.30E-06, Aligned region: 232..298
IstB_IS21 [PF01695], Evalue: 2.30E-06, Aligned region: 614..634
NACHT [PF05729], Evalue: 4.00E-06, Aligned region: 238..277
NACHT [PF05729], Evalue: 4.00E-06, Aligned region: 614..639
Zeta_toxin [PF06414], Evalue: 4.20E-06, Aligned region: 232..262
Zeta_toxin [PF06414], Evalue: 4.20E-06, Aligned region: 600..654
AAA_17 [PF13207], Evalue: 1.30E-05, Aligned region: 238..302
AAA_17 [PF13207], Evalue: 1.30E-05, Aligned region: 613..649
Sigma54_activat [PF00158], Evalue: 9.40E-05, Aligned region: 222..252
Sigma54_activat [PF00158], Evalue: 9.40E-05, Aligned region: 614..731
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 238..335
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 612..696
Clp_N [PF02861], Evalue: 0.0002, Aligned region: 22..58
Clp_N [PF02861], Evalue: 0.0002, Aligned region: 105..122
AAA_18 [PF13238], Evalue: 0.0004, Aligned region: 238..260
AAA_18 [PF13238], Evalue: 0.0004, Aligned region: 615..644
AAA_33 [PF13671], Evalue: 0.00079, Aligned region: 238..255
AAA_33 [PF13671], Evalue: 0.00079, Aligned region: 394..437
AAA_33 [PF13671], Evalue: 0.00079, Aligned region: 613..635
RNA_helicase [PF00910], Evalue: 0.0012, Aligned region: 239..260
RNA_helicase [PF00910], Evalue: 0.0012, Aligned region: 615..636
RNA_helicase [PF00910], Evalue: 0.0012, Aligned region: 851..883
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 232..254
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 610..638
ResIII [PF04851], Evalue: 0.0024, Aligned region: 222..260
ResIII [PF04851], Evalue: 0.0024, Aligned region: 308..320
ResIII [PF04851], Evalue: 0.0024, Aligned region: 586..642
AAA_23 [PF13476], Evalue: 0.0029, Aligned region: 238..255
AAA_23 [PF13476], Evalue: 0.0029, Aligned region: 441..530
AAA_23 [PF13476], Evalue: 0.0029, Aligned region: 611..637
AAA_28 [PF13521], Evalue: 0.0044, Aligned region: 238..262
AAA_28 [PF13521], Evalue: 0.0044, Aligned region: 614..634
T2SE [PF00437], Evalue: 0.0076, Aligned region: 206..257
T2SE [PF00437], Evalue: 0.0076, Aligned region: 479..505
T2SE [PF00437], Evalue: 0.0076, Aligned region: 611..692
DUF258 [PF03193], Evalue: 0.008, Aligned region: 223..255
DUF258 [PF03193], Evalue: 0.008, Aligned region: 525..566
DUF258 [PF03193], Evalue: 0.008, Aligned region: 613..626
DUF258 [PF03193], Evalue: 0.008, Aligned region: 791..836
AAA_30 [PF13604], Evalue: 0.008, Aligned region: 235..258
AAA_30 [PF13604], Evalue: 0.008, Aligned region: 611..637
Protein Sequence: 884 a.a.     [Download]
>gi|550444344|ref|YP_008659922.1| ATPase [Klebsiella pneumoniae CG43]
MENPASLLRRLNPCCARAMEGAASLCHTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDALWQDLL
SWLDKQPRSVRHRPQLSDHILRLMQEAWLIASLSGETQIRSVHLLMALVEKPNLIQCDGLWPLLTLGQRQ
LERLRSLLDAHSDERPPAQQEAALAQPHGGDVEFVGRPAGSELNADGLNPALQNALEKFTLDVTAKARDG
QIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDALKPVSVRTLDLGLL
QAGAGVKGEFEQRLKNIIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYADHHGVHITDDAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTASARLRMSLDTVPEPLTRMKAQLTALAMEKQALLEDIALGNSARGDRLAAIEQEEIRLI
LALDTLETQYGQELQLTEALLACRRDISRQAEISDLQTALIAVQQGNPLLGLDVDVRTVATVIADWTGVP
LSSLMKDEQTELLSLEESLGKRVVGQQAALSAIARRLRAAKTGLTPENGPQGVFLLVGPSGTGKTETALA
LADALFGGEKALITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVM
NLFYQVFDRGGMRDGEGREIDFRNTVILMTANLGSDLLMQLLDEQPQASESDLHELLRPVLRGHFQPALL
ARFQTVIYRPLPAGALRAIVGMKLGQVSQRLACHYGITTTLSESLFDALTEACLLPDTGARNVDSLLNQQ
ILPALSQQLLSHMAAGQKPRQVTLGYHEEEGVVMAFDEGTISDE
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|550443072|ref|NC_022566.1|:1462304-1464958 Klebsiella pneumoniae CG43, complete genome
ATGGAAAATCCAGCCAGCCTGTTACGCCGTCTTAATCCCTGCTGTGCCCGCGCAATGGAGGGGGCGGCCT
CCCTGTGCCATACCCGGGCGCATGCCGAGATCCTGCCCGAGCACTGGCTGCTTAAACTGCTTGAACAGGG
GGAAGGCGATCTGACGGTGCTGGCGCGGCGCTATGAATGGGATATGGATGCGCTGTGGCAGGATCTGCTG
AGCTGGCTGGATAAACAGCCGCGCTCGGTACGTCATCGTCCCCAGCTCTCTGACCATATCCTGAGGCTGA
TGCAGGAGGCCTGGCTGATTGCCTCGCTCAGCGGCGAAACGCAGATCCGCAGTGTTCACCTGCTGATGGC
GCTGGTTGAAAAACCGAATCTGATCCAGTGCGATGGCCTGTGGCCGCTGTTAACGCTGGGCCAGCGTCAG
CTGGAACGCCTGCGCTCCTTGCTGGATGCCCATTCCGACGAACGTCCGCCAGCGCAGCAGGAAGCGGCGC
TGGCGCAGCCCCATGGCGGGGACGTGGAATTTGTGGGGCGTCCTGCGGGCAGCGAACTGAATGCGGATGG
GCTCAATCCAGCGCTGCAGAACGCGTTGGAAAAATTCACTCTCGACGTCACCGCCAAAGCCAGAGACGGC
CAGATTGACCCGGTGTTCGGACGCGACACGGAAATCCGCCAGATGGTGGATATTCTCTCCCGTCGGCGAA
AAAACAACCCGATCCTCGTCGGTGAGCCGGGCGTGGGCAAGACCGCTCTGGTGGAAGGCCTGGCGCTGCG
CATTGCCGAAGGCAACGTCCCCGACGCGCTGAAGCCGGTGTCGGTGCGCACCCTTGACCTCGGTCTGCTG
CAGGCCGGCGCCGGGGTCAAAGGCGAGTTCGAGCAGCGGCTGAAAAATATCATTGAGGCGGTACAGCAGT
CGCCTTCGCCGGTGCTGCTGTTTATCGACGAGGCGCACACGATCATCGGCGCGGGTAATCAGGCGGGCGG
CGCGGATGCCGCCAACCTGTTGAAGCCGGCGTTGGCCCGGGGCGAGCTGCGGACCATCGCCGCCACCACC
TGGTCTGAATACAAGCAGTACTTCGAGCGCGACGCCGCGCTGGAGCGCCGCTTTCAGATGGTCAAGGTGG
ATGAGCCGGACGACGACACCGCCTGCCTGATGCTGCGCGGCCTGAAGTCCCGCTATGCCGACCACCACGG
CGTGCATATCACGGATGATGCGGTGCGCGCCGCCGTGACGCTGTCACGACGCTATCTTACCGGTCGCCAG
CTGCCGGACAAGGCAGTGGATTTACTCGACACCGCTTCCGCCCGCCTGCGTATGAGTTTGGATACCGTGC
CTGAGCCGCTGACCCGCATGAAGGCGCAGCTCACCGCGCTGGCAATGGAGAAGCAGGCGCTGCTGGAAGA
TATTGCGCTGGGCAACAGCGCCCGCGGCGATCGGCTGGCGGCCATTGAGCAGGAGGAGATCCGCCTTATT
CTGGCGCTGGATACCCTTGAAACTCAGTATGGTCAGGAGCTGCAGCTGACGGAAGCGCTGCTCGCCTGTC
GCCGCGATATCTCCCGCCAGGCGGAAATTAGCGATCTACAAACCGCGCTTATCGCCGTCCAGCAGGGCAA
TCCGCTGCTCGGGCTGGACGTCGACGTCCGCACCGTGGCGACGGTGATTGCCGACTGGACCGGCGTGCCG
CTCTCCTCGCTAATGAAAGATGAGCAGACGGAGCTGCTGAGTCTGGAAGAGAGTCTCGGCAAACGGGTGG
TTGGCCAGCAGGCGGCCCTGAGCGCTATTGCCCGGCGCCTGCGCGCCGCGAAAACCGGCCTGACGCCGGA
GAACGGTCCGCAAGGGGTGTTCCTGCTGGTCGGGCCGAGCGGCACCGGCAAAACGGAAACGGCGCTCGCC
CTAGCCGATGCGCTGTTCGGCGGCGAGAAAGCGCTGATCACCATCAATCTCTCCGAGTACCAGGAGCCGC
ACACCGTCAGCCAGCTGAAGGGTTCTCCGCCCGGCTACGTCGGCTACGGCCAGGGCGGGATCCTGACCGA
GGCGGTGCGCAAACGCCCCTACAGCGTGGTGCTGCTCGATGAGGTGGAAAAGGCCCATCGCGATGTGATG
AACCTGTTCTACCAGGTCTTCGACCGGGGGGGAATGCGCGACGGCGAGGGGCGTGAAATCGACTTTCGCA
ACACCGTGATCCTGATGACCGCCAACCTCGGTAGCGACCTCCTGATGCAGCTGCTGGATGAACAGCCGCA
GGCCAGCGAATCAGACCTGCACGAGCTGCTGCGCCCGGTGCTGCGCGGCCACTTCCAGCCGGCGCTGCTG
GCCCGCTTCCAGACGGTGATTTACCGTCCGCTGCCGGCGGGAGCGCTGCGCGCCATTGTCGGCATGAAGC
TCGGGCAGGTAAGTCAGCGTCTGGCTTGCCATTACGGAATCACCACCACCCTCAGCGAGAGCCTGTTCGA
CGCGCTGACCGAGGCCTGCCTGCTGCCGGATACCGGCGCCCGTAACGTCGACAGTCTGCTCAATCAGCAG
ATCCTGCCGGCACTGAGTCAGCAGCTATTGAGCCATATGGCGGCGGGGCAGAAACCGCGCCAGGTGACGC
TGGGGTATCACGAAGAGGAAGGCGTCGTGATGGCGTTTGACGAGGGGACAATATCCGATGAGTAG