SecReT6
Protein ID: 550444345
SecReT6 ID858
T6SS typei2
Gene symbol-
Locus tagD364_06910
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]1464951..1467329 [+]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDU5MAF0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-66, Aligned region: 34..356
DUF2345 [PF10106], Evalue: 3.50E-42, Aligned region: 613..759
T6SS_Vgr [PF13296], Evalue: 1.70E-35, Aligned region: 489..591
T6SS_Vgr [PF13296], Evalue: 1.70E-35, Aligned region: 628..677
Phage_base_V [PF04717], Evalue: 1.10E-16, Aligned region: 339..358
Phage_base_V [PF04717], Evalue: 1.10E-16, Aligned region: 389..482
Protein Sequence: 792 a.a.     [Download]
>gi|550444345|ref|YP_008659923.1| type IV secretion protein Rhs [Klebsiella pneumoniae CG43]
MSSVKSLLFSHNHHLLSVKGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAASLTLQAP
VAQGFGINVQQPVRVIQGVVTGFERLSTSRDETHYALTLQPRLALLNRSHQNAIYQDQSVPQIVEKILRE
RHGLRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLHIDVAEFCDSQQGYEKG
LTLPSVPPSGQQSAGVDAVWEMACRHRVVEQQVSTRDYNYREATADMNAQVDVTRGETTTFGEAYHWGDN
YLTAGNAHDRHPAPESGAFYARLRHERYLNGQTRMQATTSCPTLCPGQVLKVTGGEEVAGEFADGVLITA
MHSHARRDADFAVEFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYRVNMLFDR
ARWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVTIRNDKRN
VLRTPANNKIRLDDERGKEHIKLSTEYGGKSQLNLGHLVDSDRQPRGEGFELRTDSWGAIRAQKGIFISA
DGQAQAQGQVLDMEPAVSLLKGAVNQVTEWGSITQTHHNVIPDTGPLSALTTGASDLKQPTLLMSAPQGI
AAVTPETTLLHSGNGLYLQSLGEVNITTAQRCSLNASQAISLLAQQEGMRLVSAKGPLQVESHGDILSLT
ALKDITVQSTQGHLQLTAKNGITLGCGGAYIRLTPQGEVQIHGPGVISLKGQHDLQGPVSEEFPLPELPA
SVCKECLKKAQALAQGFVPREA
 
Nucleotide Sequence: 2379 bp     [Download]
>gi|550443072|ref|NC_022566.1|:1464951-1467329 Klebsiella pneumoniae CG43, complete genome
ATGAGTAGCGTGAAATCGTTGTTGTTCAGCCATAACCACCACCTGCTTTCGGTGAAGGGATGTGAAGCCG
GGCTTGATGTGCTGGCCTTCGAGGGCGATGAAGCCCTGAGCCAGCCGTTCCGCTACCGTATTGAATTCAC
CAGCGCAGACCATGCCATCAGCAAAGAGATGATGCTGATGAAGGCAGCCTCCCTGACGCTGCAGGCGCCG
GTGGCTCAGGGCTTCGGCATCAATGTTCAGCAACCCGTGCGGGTGATCCAGGGCGTGGTGACGGGGTTTG
AACGGCTCAGTACCTCCAGGGATGAAACGCACTACGCGCTGACGCTTCAGCCGCGCCTGGCGCTGCTTAA
CCGCTCGCACCAGAACGCCATTTACCAGGACCAGTCCGTTCCGCAGATTGTGGAAAAAATCCTCCGCGAG
CGCCACGGCCTGCGCGGTCAGGATTTTCTGTTCTCGCTGACAAAAACGTATCCGCGCCGCGAGCAGGTGA
TGCAGTACGGCGAGGATGACCTGCGCTTTATCACCCGGCTGCTGGGTGAGGTGGGGATCTGGTTTCGGTT
TACCGCCGACACGCGGCTGCACATCGACGTCGCTGAGTTCTGCGACAGTCAGCAGGGCTATGAGAAGGGG
CTGACGTTGCCTTCGGTCCCGCCGTCAGGGCAGCAGTCGGCCGGGGTGGACGCGGTGTGGGAGATGGCAT
GCCGCCACCGCGTCGTGGAGCAGCAGGTCAGTACCCGCGACTACAACTACCGCGAGGCGACGGCGGACAT
GAACGCGCAGGTGGATGTCACCCGCGGGGAGACCACCACCTTTGGTGAGGCTTACCACTGGGGAGATAAC
TACCTGACCGCGGGGAATGCCCATGACCGCCATCCGGCGCCGGAGTCCGGGGCGTTTTACGCCCGGCTTC
GGCATGAGCGTTATCTTAACGGCCAGACCCGGATGCAGGCCACCACCAGCTGCCCGACGCTCTGCCCGGG
ACAGGTGCTGAAGGTCACCGGCGGAGAGGAGGTGGCCGGGGAGTTTGCTGATGGCGTGCTCATCACGGCG
ATGCACAGCCACGCCCGGCGCGATGCCGACTTTGCGGTGGAGTTTGCCGGCATACCGGACAGCCCGGACG
TCGGCTACCGGCCTGAGCCCGGCGCGCGTCCGGTGATGGCCGGGACGCTGCCGGCCCGCGTGACCAGCAC
CCGGGAAAACGACACCTACGGGCATATCGACAAACACGGACGCTACCGGGTGAATATGTTGTTTGATCGG
GCGCGCTGGGAAACCGGGTTCGAGAGCCTGTGGGTCCGTCAGTCGCGGCCGTATGCCGGAGACACTTACG
GCCTGCACCTGCCGCTGCTGGCCGGGACGGAGGTGGCGATTGGCTTTGAGGATGGTAACCCCGACCGGCC
GTATATCGCGGGCGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATTCGCAATGACAAACGTAAC
GTCCTGCGCACCCCGGCCAACAACAAAATCCGCCTCGACGACGAGCGCGGGAAAGAGCATATCAAGCTCT
CGACGGAGTACGGCGGCAAGAGCCAGCTGAACCTGGGGCACCTGGTGGACAGTGACAGGCAGCCGCGCGG
CGAAGGCTTTGAGCTGAGAACCGACAGCTGGGGAGCTATCCGGGCACAGAAAGGGATATTTATCAGCGCG
GACGGACAGGCGCAGGCTCAGGGGCAGGTGCTGGATATGGAGCCGGCGGTCAGTTTGCTGAAAGGTGCGG
TGAATCAGGTCACGGAATGGGGAAGCATTACGCAAACCCATCATAATGTTATCCCAGACACCGGCCCATT
AAGCGCACTGACCACAGGCGCCAGCGATCTTAAACAGCCGACATTGCTGATGTCGGCCCCGCAGGGGATT
GCCGCAGTCACGCCGGAAACAACCCTCCTGCACAGCGGTAACGGACTGTATCTGCAGAGCCTGGGAGAGG
TCAACATCACCACGGCACAGCGCTGTTCTCTGAATGCCAGCCAGGCTATTTCACTGCTGGCGCAACAGGA
GGGGATGAGGCTGGTCTCCGCCAAAGGTCCGCTGCAAGTAGAGTCGCACGGCGATATTCTATCGCTGACC
GCGCTAAAAGATATCACAGTCCAGTCAACCCAGGGGCATCTGCAGTTGACGGCTAAAAATGGCATCACCC
TGGGTTGCGGCGGCGCATATATCCGTCTTACCCCGCAGGGAGAGGTACAGATCCACGGACCGGGGGTGAT
TAGCCTTAAGGGGCAGCATGATTTGCAGGGGCCGGTCAGCGAGGAGTTTCCCTTGCCTGAGCTACCGGCA
TCGGTGTGTAAAGAGTGCCTTAAAAAAGCCCAGGCGCTGGCGCAGGGCTTCGTGCCGCGGGAGGCATAG