SecReT6
Protein ID: 550444352
SecReT6 ID858
T6SS typei2
Gene symbol-
Locus tagD364_06950
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]1477615..1479369 [+]
Producttype VI secretion protein ImpG
NoteTssF
UniProt IDU5MDY2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.10E-181, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|550444352|ref|YP_008659931.1| type VI secretion protein ImpG [Klebsiella pneumoniae CG43]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPFVERLFEGFAFLMGRMREKLDDDLPE
LTEGVVSLLWPHYLRTIPSMSVVEFTPDWPEMKEPMTMAKGFEVLSRPIGEKGTRCRYTTTKAIALQPLS
LERVQLATDTDGRSVITLRFTCSQLTDWRRVDLSHIPLYCNADAPLACAMHEAFTLNVARMWLRMPDEVD
RRPLDGYFSALGFGEDDGLWPEDGRSFRGYQLLLEYFTFREKFMFIDLRGLETVAFPAGLAWFEIDVVLA
ERWEHDFRFSEKQLRLHCVPVINLFPLESDPLTINSLQTEYPLRPMRVQDGHTEIYTVDSVISSHQQVYA
PFSSFRHKGGMMRHDAADYYYHTRVRRGPSGLYNTWLIVGGEAFDNHTVPEDESLSLTLTGTNGQLPRRA
LQSTVLDTVMKTTSASIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSSFLSLMDNAEVLRGTLALYEWTD
SEMNRRRLEAILDVKHRATERFAQGHLVRGVQIEVTLDSHGFVGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHSRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|550443072|ref|NC_022566.1|:1477615-1479369 Klebsiella pneumoniae CG43, complete genome
ATGGACGATTTAACCCTGCGTTATTACGACGCTGAAATGCGCTACCTGCTGGAAGCGGGTGAAGAGTTTG
CCCGCGCTCATCCTGAGCAGGCGGCAATGCTCAATCTCGACAAAGCGGGCGCTCGCGACCCCTTTGTCGA
GCGTCTGTTTGAAGGTTTTGCCTTCCTGATGGGCCGCATGCGCGAGAAACTCGATGACGATCTGCCTGAG
CTGACCGAAGGCGTGGTCAGTCTGCTGTGGCCACATTATTTACGTACCATTCCCTCGATGTCGGTCGTGG
AGTTCACCCCCGACTGGCCGGAAATGAAAGAGCCGATGACGATGGCCAAAGGCTTTGAAGTGCTTTCCCG
GCCGATCGGTGAAAAGGGCACGCGCTGCCGGTACACCACCACCAAAGCGATCGCTCTGCAGCCGTTATCC
CTGGAACGCGTCCAGCTGGCCACCGATACGGATGGCCGGTCGGTGATCACGCTGCGCTTTACCTGCAGCC
AGCTGACGGACTGGCGCCGGGTCGATCTCAGTCATATCCCGCTGTACTGCAACGCCGATGCGCCGCTGGC
CTGCGCCATGCACGAGGCCTTTACCCTCAATGTGGCCCGGATGTGGCTGCGCATGCCCGATGAGGTGGAC
AGAAGGCCGCTGGACGGGTATTTCAGCGCGCTGGGATTTGGCGAGGATGACGGCCTCTGGCCTGAAGATG
GCCGCAGTTTTCGCGGTTACCAGCTGCTGCTGGAGTATTTTACCTTCCGCGAAAAGTTCATGTTCATCGA
TCTGCGCGGGCTGGAGACGGTGGCTTTTCCGGCCGGACTGGCGTGGTTTGAAATCGACGTCGTGCTGGCG
GAACGCTGGGAACATGACTTCCGCTTCAGCGAAAAGCAGCTGCGCCTGCACTGCGTGCCAGTGATCAACC
TGTTTCCGCTGGAGTCCGATCCGCTGACCATCAATTCCCTGCAGACCGAATACCCGCTGCGCCCGATGCG
CGTGCAGGACGGCCACACCGAAATTTACACCGTCGATTCCGTGATCTCCTCACACCAGCAGGTTTACGCG
CCGTTCTCAAGTTTTCGCCACAAAGGCGGCATGATGCGTCATGACGCGGCGGACTATTACTATCATACCC
GGGTGCGCCGTGGCCCCTCCGGGCTGTACAACACCTGGCTTATCGTCGGCGGAGAAGCCTTTGATAATCA
TACCGTACCGGAAGATGAAAGCCTGTCGCTGACCCTCACCGGAACCAACGGCCAGCTGCCGCGTCGCGCG
CTGCAGAGCACCGTGCTCGATACGGTGATGAAAACCACTTCCGCCAGTATTGCAGTGCGTAACCTCTGCG
CGCCGACGCTGCCGTGCTATCCCCCCGCCCAGGACCGTTTTCACTGGCGGGTGCTGAGCCATCTGGGCAG
CAGTTTTCTTTCCCTGATGGATAACGCGGAGGTCCTGCGCGGCACCCTGGCGCTGTATGAATGGACCGAC
AGCGAGATGAATCGTCGGCGTCTGGAAGCCATCCTCGACGTGAAGCACCGCGCAACAGAGCGCTTTGCAC
AGGGCCATCTGGTGCGCGGCGTACAGATTGAAGTCACCCTCGACAGTCACGGCTTTGTCGGACGAGGCGA
TATATGCCTGTTTGGCGAGATGCTTAGCCGCTTCTTCGCGCTCTACACCGACATCTACTTGTTCAACCGC
CTGATTATCATTCTGCAACCAACCGGAGAACGACTGGAATGGGAAGAGAAGCACAGCCGCCGCATTCCCG
GCTGA