SecReT6
Protein ID: 550444353
SecReT6 ID858
T6SS typei2
Gene symbol-
Locus tagD364_06955
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]1479333..1480418 [+]
Producthypothetical protein
NoteTssG
UniProt IDU5MAJ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.90E-73, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|550444353|ref|YP_008659932.1| hypothetical protein D364_06955 [Klebsiella pneumoniae CG43]
MGREAQPPHSRLTPRLEADLPRINFYRFCQLLEKRRPGQPLMGGTSHPADDPVRFYPHPGMGFPASELKA
VEYDEADDSRPPVIRTTFMGLYGVDSPLPTAYLDDIAQHREGHEALQGLLDIFSHRIMTQFYRIWRKYSW
PATFEPGGTDRLSQSLLGLAGLGIPGTTQHIASPASRFLALTGVLRQPGKTQQGIQALVTLLAPETTVRV
SPYSLRPVAISQPLGFYGDDDFFLDGNTPLGDEAMDASSQLLVALTTDNPAEAQGWKPDGPLFRDFLILL
RVYLGWRFRANITLTAPTRLLAVPPLGDEPFWLGMNGVLGVGQGESEDDIPQTFTTELGTYTGLQPATFL
QGNRRVTYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|550443072|ref|NC_022566.1|:1479333-1480418 Klebsiella pneumoniae CG43, complete genome
ATGGGAAGAGAAGCACAGCCGCCGCATTCCCGGCTGACCCCGCGACTGGAGGCCGACCTGCCGCGGATCA
ATTTTTACCGCTTCTGCCAGCTTCTGGAAAAACGGCGTCCCGGCCAACCGCTGATGGGGGGAACCAGCCA
TCCGGCTGACGATCCGGTGCGTTTTTACCCGCATCCGGGAATGGGATTTCCCGCCAGCGAACTGAAAGCC
GTGGAATACGATGAGGCCGATGACAGCAGGCCGCCGGTCATTCGCACCACCTTTATGGGGTTGTACGGTG
TCGATTCGCCGCTCCCGACGGCATATCTCGATGATATCGCCCAGCACAGGGAAGGGCATGAAGCGCTGCA
GGGCTTACTGGATATCTTCAGCCACCGGATCATGACGCAGTTTTACCGCATCTGGCGGAAATACTCCTGG
CCCGCCACCTTTGAGCCCGGCGGCACCGATCGTCTCTCGCAGTCGCTACTGGGCCTGGCGGGGCTAGGCA
TCCCCGGCACGACGCAGCATATCGCCTCGCCGGCGTCGCGCTTTCTGGCGCTAACCGGCGTGCTGCGTCA
GCCGGGCAAAACCCAGCAGGGGATCCAGGCGCTGGTCACCCTGCTGGCCCCGGAGACCACCGTCAGGGTG
AGCCCGTACAGCCTGCGTCCGGTGGCGATCAGCCAGCCGCTGGGGTTTTACGGCGATGACGACTTCTTCC
TGGACGGCAATACGCCGCTGGGTGACGAAGCGATGGATGCCAGCAGCCAGCTCCTCGTCGCCCTTACCAC
CGACAATCCCGCGGAGGCGCAGGGCTGGAAGCCTGACGGCCCGCTGTTTCGGGACTTTCTCATCCTGCTG
CGGGTATACCTCGGCTGGCGATTCCGGGCCAACATCACCCTGACCGCGCCGACCCGACTGCTGGCTGTCC
CGCCGCTGGGGGACGAGCCGTTCTGGCTCGGTATGAACGGCGTGCTGGGCGTGGGTCAGGGCGAGAGTGA
GGACGATATTCCTCAGACCTTTACCACCGAGCTGGGTACCTATACGGGCCTGCAGCCTGCCACCTTTCTA
CAAGGAAACCGACGTGTTACGTATAAGTTTGACTAA