SecReT6
Protein ID: 550445174
SecReT6 ID859
T6SS typeN/A
Gene symbol-
Locus tagD364_11495
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]2383458..2383901 [-]
Producthypothetical protein
NoteTssE
UniProt IDU5MC66
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-16, Aligned region: 26..113
Protein Sequence: 147 a.a.     [Download]
>gi|550445174|ref|YP_008660824.1| hypothetical protein D364_11495 [Klebsiella pneumoniae CG43]
MPRPSLYDILYGNFAGGLDLNTVSETDQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTAVLQGMPASA
HQLMSTLSAVLLKYEPRLQRIAVVMLDQHAPGELRYAIDAELKDIGLVRYGTEFMPEGRVLIRHLKRQQY
LDARSAL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|550443072|ref|NC_022566.1|:c2383901-2383458 Klebsiella pneumoniae CG43, complete genome
ATGCCTCGTCCCTCCCTGTATGACATCCTGTACGGCAATTTCGCCGGCGGGCTTGACCTGAATACTGTCA
GCGAAACGGATCAGGTCATCCTGTCAGTGCTCGATAACATGCAGCGCATCCTCAACTGTCGGGCCGGAAC
GCTGGCGCATCTGCCGGACTACGGCCTGCCGGATATGACCGCTGTCCTCCAGGGGATGCCAGCGTCGGCG
CATCAGCTGATGAGCACGTTGTCGGCGGTGTTGCTGAAATACGAACCGCGCCTGCAGCGGATCGCGGTGG
TGATGCTCGATCAGCATGCGCCCGGCGAACTGCGCTATGCCATTGATGCGGAGCTGAAGGATATTGGCCT
GGTGCGTTACGGCACGGAGTTTATGCCCGAGGGCAGGGTGTTGATCCGCCACCTCAAACGTCAGCAGTAC
CTTGACGCCCGCTCCGCCCTCTAA