SecReT6
Protein ID: 550445175
SecReT6 ID859
T6SS typeN/A
Gene symbol-
Locus tagD364_11500
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]2383904..2384446 [-]
Producttype VI secretion protein
NoteTssJ
UniProt IDU5MCS6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-38, Aligned region: 21..171
Protein Sequence: 180 a.a.     [Download]
>gi|550445175|ref|YP_008660825.1| type VI secretion protein [Klebsiella pneumoniae CG43]
MKMAITAVKPSARLLAFLMVTVLTGCGLTQTVKDGAVSVTQSIFYPQVKTLHLDLRAREGVNNNAKGASL
ATVVRIYQLKDRQAFDNTDYPSLFAGDGQALQADRVAEKDVRLRPGESVTVDMPMETSAQFVAVAAMFID
PDLTQNSWRLVLTRDELDPARPRIIEASQNQLTLHPFKEK
 
Nucleotide Sequence: 543 bp     [Download]
>gi|550443072|ref|NC_022566.1|:c2384446-2383904 Klebsiella pneumoniae CG43, complete genome
ATGAAGATGGCGATTACCGCAGTTAAACCCTCCGCCAGGTTGCTGGCATTCCTCATGGTTACCGTCTTAA
CCGGCTGCGGACTGACGCAGACCGTGAAAGACGGCGCCGTTTCCGTGACCCAGTCCATTTTTTACCCCCA
GGTGAAAACCCTGCATCTGGATCTTCGCGCCCGGGAAGGCGTGAATAACAATGCCAAAGGCGCCTCCCTG
GCGACGGTGGTGCGTATTTATCAGCTGAAGGACCGGCAAGCGTTCGACAATACTGACTACCCGTCGCTGT
TTGCCGGCGATGGCCAGGCGCTGCAGGCGGACCGGGTGGCGGAAAAAGATGTTCGCCTGCGTCCGGGCGA
ATCGGTGACCGTCGATATGCCCATGGAAACCAGCGCGCAGTTTGTGGCGGTGGCGGCCATGTTTATCGAT
CCAGACCTGACGCAAAACAGCTGGCGGCTGGTACTCACCCGGGACGAACTTGATCCGGCGAGGCCGCGCA
TTATCGAAGCCAGCCAAAATCAACTGACGCTGCACCCGTTTAAGGAGAAGTGA