SecReT6
Protein ID: 550445176
SecReT6 ID859
T6SS typeN/A
Gene symbol-
Locus tagD364_11505
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]2384421..2385467 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDU5MFH6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.30E-82, Aligned region: 8..309
Protein Sequence: 348 a.a.     [Download]
>gi|550445176|ref|YP_008660826.1| type VI secretion protein [Klebsiella pneumoniae CG43]
MAQLRPQLPYMNFYRFCQLLEKNHPKAPIIGSGWLVGDEPIRFRPHPGMGFPAGEIRGMDDPEPPRPPAV
RVTFMGLYGVESPLPTHYSDDIAQRREGVEATEDFLDIFNHRLIAQYYRIWRKYSYPATFRAGGTDNISQ
YLLGLAGLGIPGCAAVAAAPLSRFLALLPVMMLPGRSGEGMEALVALLAPGTRATVYHHDPCRIPLSQPL
TMSVRQPVSLQHRPVMGTHATDVNGQVLLQLATEKPDEVRGWLPGGELFSDLMALLHVWLGSHLDVRLQL
CVARHLLPDAQLCCQQEHAVQLGRTAVLRPLDAQKQADDRVTIYLGRYQRVRENIHRRESDEDGDYRS
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|550443072|ref|NC_022566.1|:c2385467-2384421 Klebsiella pneumoniae CG43, complete genome
ATGGCGCAGCTCCGGCCTCAGTTGCCGTACATGAATTTTTACCGCTTCTGCCAGTTGCTGGAGAAGAACC
ATCCGAAGGCGCCGATCATCGGCAGCGGCTGGCTAGTAGGTGATGAACCCATACGCTTTCGCCCGCATCC
GGGGATGGGCTTTCCGGCTGGCGAAATCCGTGGAATGGACGATCCTGAACCGCCCCGTCCGCCGGCGGTT
CGCGTGACTTTTATGGGACTCTACGGCGTGGAATCCCCGCTGCCGACCCACTATAGCGATGACATTGCGC
AACGGCGGGAAGGCGTCGAGGCCACCGAGGATTTCCTCGATATCTTTAACCATCGGCTGATCGCCCAGTA
TTACCGTATCTGGCGCAAATATTCCTACCCGGCAACCTTTCGGGCGGGCGGCACGGACAACATCTCGCAG
TATCTGCTGGGCCTGGCGGGGCTGGGCATACCGGGATGTGCCGCCGTTGCCGCAGCGCCGCTGTCGCGAT
TTCTGGCGCTGCTGCCGGTGATGATGCTGCCGGGGAGATCCGGGGAAGGCATGGAGGCGCTGGTGGCGCT
CCTGGCCCCGGGGACCCGGGCGACGGTGTACCACCACGATCCCTGCCGGATCCCCTTGTCGCAGCCGTTA
ACGATGAGCGTCCGTCAGCCGGTTAGCCTGCAACATAGGCCAGTGATGGGAACCCACGCCACGGATGTGA
ACGGTCAGGTGTTGCTGCAGCTGGCCACGGAAAAGCCTGATGAGGTTCGCGGCTGGCTGCCCGGCGGCGA
ACTGTTCAGCGACCTGATGGCGCTTCTGCACGTCTGGCTCGGATCTCATCTTGACGTGCGGCTGCAGCTT
TGCGTCGCCCGCCATTTACTGCCGGATGCGCAACTTTGCTGCCAGCAGGAGCATGCCGTCCAGCTCGGCC
GTACCGCTGTGCTGCGTCCTCTGGATGCGCAGAAACAGGCTGACGACAGAGTCACGATTTATCTGGGGCG
CTATCAGCGCGTCCGGGAAAATATTCACCGCAGGGAGAGCGATGAAGATGGCGATTACCGCAGTTAA