SecReT6
Protein ID: 550445177
SecReT6 ID859
T6SS typeN/A
Gene symbol-
Locus tagD364_11510
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]2385467..2387230 [-]
Producttype VI secretion protein ImpG
NoteTssF
UniProt IDU5MGA7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.90E-182, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|550445177|ref|YP_008660827.1| type VI secretion protein ImpG [Klebsiella pneumoniae CG43]
MDDLTLRYFDAEMRYLREAAKAFAQAHPDRAAMLDLDKAGTPDPYVERLFEGFAFSVGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSIVALTPTLPAMKIAETVPAGFEISSRPLGPKNTVCRYRTTRDLTLNPLA
IEEAVMTAEQDGRSALRLRFACSELADWSQTDLRHLALYLGEDAVTGSALHLWLTRRQAALYLRLPGQTE
RVSLDGYFSPGGFSEEDRLWPKGESAFSGYQLLLEYFTFREKFMFVQLNGLENITLPAGISHFTLEVVFC
EVWQSDLPVSASSLRLHCVPVINLFTLEADPLTISGLESEYLLRPKRLQDGHTEIYSVDSVTGSGRTGEA
RYVPFTRFRHQGGMMRRHAPERYYHTRVKRGVTGMHDTWLILGGQRWEADRELARETVSLRITGTNGQLP
RRALQSTLLDRCESISATPLTVRNLCKPTLPAYPPAEDRYHWRVMSHLGTRFLNMMSSAEVLRGTLSLYN
WREDELNNRRLDAILAVSHHRIQRFEQGFLLRGLDIEVTLDGSGFTGAGDVHLFGDMLNRFFALYADMNQ
FNQLTLIVQPEGKCIRWKENHSLRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|550443072|ref|NC_022566.1|:c2387230-2385467 Klebsiella pneumoniae CG43, complete genome
ATGGACGATTTAACCCTGCGATATTTTGATGCTGAAATGCGCTACCTGCGCGAGGCGGCAAAAGCGTTCG
CGCAGGCTCACCCCGATCGGGCGGCGATGCTGGATCTCGATAAAGCCGGTACGCCGGACCCTTACGTTGA
GCGCCTGTTTGAAGGCTTTGCCTTTTCCGTAGGTCGCTTGCGCGAAAAAATTGATGATGATCTGCCGGAG
CTGACCGAGGGGCTGGTCAGCATGCTGTGGCCGCACTATTTGCGCACTATTCCATCGCTATCGATCGTAG
CGCTGACCCCAACGCTGCCGGCGATGAAGATAGCGGAAACGGTGCCCGCCGGGTTTGAGATTAGCTCCCG
CCCACTGGGGCCGAAAAATACCGTGTGCCGGTACCGAACCACCCGCGATCTGACGCTTAACCCGCTGGCG
ATAGAGGAGGCGGTGATGACGGCGGAGCAGGACGGACGTTCGGCCCTGCGACTACGATTCGCCTGTAGCG
AGCTGGCTGACTGGTCGCAGACCGATCTCCGCCACCTGGCGCTGTACCTGGGGGAAGACGCTGTTACCGG
CAGCGCCCTCCATCTGTGGCTGACCCGACGCCAGGCCGCGCTGTACCTGCGTCTGCCGGGTCAGACAGAG
CGGGTAAGCCTCGACGGCTATTTTTCCCCGGGGGGATTCAGCGAGGAGGATCGTTTATGGCCGAAGGGGG
AGAGCGCTTTCAGCGGCTATCAGCTGCTGCTCGAGTATTTCACCTTTCGCGAAAAATTTATGTTCGTGCA
GCTAAATGGCCTGGAAAACATCACCCTGCCGGCGGGGATATCGCATTTCACGCTTGAGGTGGTGTTCTGC
GAGGTCTGGCAAAGTGATTTACCCGTCAGCGCAAGCAGCCTGCGCCTGCACTGTGTGCCGGTGATTAACC
TGTTTACCCTTGAGGCCGATCCGTTGACCATCAGCGGCCTGGAGAGCGAATACCTCCTGCGTCCGAAGCG
CCTGCAGGACGGGCATACCGAAATCTATTCTGTTGACAGCGTGACCGGCTCCGGGCGCACCGGGGAGGCA
CGCTATGTGCCTTTCACCCGCTTTCGTCACCAGGGGGGAATGATGCGTCGCCATGCGCCGGAGCGCTACT
ACCACACCCGCGTAAAACGGGGCGTAACCGGCATGCACGATACCTGGCTTATCCTCGGCGGACAGCGATG
GGAGGCTGACCGGGAGCTGGCGCGGGAAACGGTCTCCTTGCGCATCACCGGCACTAACGGCCAGCTGCCG
CGCCGGGCGCTACAGAGCACGCTGCTGGATCGCTGTGAGTCGATATCAGCCACGCCGCTTACCGTCCGCA
ATCTCTGTAAGCCCACGCTGCCGGCCTATCCCCCGGCGGAAGACCGCTACCACTGGCGGGTCATGAGCCA
TCTGGGCACCCGTTTTCTCAACATGATGAGCAGCGCCGAGGTGCTGCGCGGCACGCTGTCGCTCTACAAC
TGGCGGGAGGATGAGCTCAATAATCGCCGTCTGGACGCCATTCTGGCGGTCAGCCATCACCGAATTCAGC
GTTTCGAGCAGGGCTTCCTGCTGCGCGGGCTGGATATCGAAGTGACGCTCGACGGTAGCGGATTTACCGG
TGCGGGCGATGTCCACCTGTTTGGCGATATGCTCAACCGCTTTTTCGCACTGTATGCCGATATGAATCAG
TTCAACCAGCTGACGCTCATTGTTCAACCTGAAGGGAAATGTATCCGGTGGAAAGAGAATCACAGTCTGC
GCCTGCCCGGCTGA