SecReT6
Protein ID: 550445179
SecReT6 ID859
T6SS typeN/A
Gene symbol-
Locus tagD364_11540
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]2397164..2399650 [-]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDU5MC71
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.20E-64, Aligned region: 35..355
Phage_GPD [PF05954], Evalue: 4.20E-64, Aligned region: 753..781
DUF2345 [PF10106], Evalue: 6.00E-55, Aligned region: 605..759
T6SS_Vgr [PF13296], Evalue: 4.20E-33, Aligned region: 487..593
Phage_base_V [PF04717], Evalue: 1.50E-15, Aligned region: 387..482
Protein Sequence: 828 a.a.     [Download]
>gi|550445179|ref|YP_008660833.1| type IV secretion protein Rhs [Klebsiella pneumoniae CG43]
MDTSSIITGTTLNRYQLDIPSCTASLDVEEFSGAEKLSELYYYTITFTSAEKNIDAAQLLSKPAMLTMGG
GALQQLADCKRVHGVVTAFRRISSSEDQSTYQITLQPFLSLLDKQFRSHRFFVNKSVPEVVEQVLQEHHL
HDWEYEFNLKQHYPRREQINQYQESDLAFIQRLLAEVGIFYFFTLQEEAQSEVVHFADAQRALMFDKTLP
VNSPSGMSDSGAESIWGLNITHNVVEANVTTRDYNPRDAQSVLQSATADMTRGNGEGITYGEVYHYKLRH
RERGDKIDPQTETANFYARLDHERFLAHQTLITAISTAAWLAPAQVLTVTDSLPSTLPAPVQDPLLITGT
GFTASRREALRVSLLAVPYSETLCWRPPLLPRPKVTGTMTARVTSAKANDIYAWQDASGLYRVKFDPDRD
EKGQGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDPVTEKNSTRNV
IRTPANNKLRMEDKRGEEHIKLSTEYGGKTQLNLGHNVNAQRELRGEGAELRTDKWVSIRGGAGVFISAD
KQPSAGDRMLAMEEAIAQLENALGIAKSLASAAESAQALPSDTGNQQTLNDALKELAQPGIVLNAPQGVS
ISSPQAVRLSSGSACVGIVSQQNTDISALKRFTVAAGEAVSLLARKAGMKLFAAKGKIEIQAQDDALEAT
AKKDITVTSVEGRVEITAAEELVVNCAGAYIRLSGGNIELGCPGNILLKSANVQKMGAADYDANKPELPV
GFSEFFTAKDEESGEILPFTRYRITTGEGKVFEGRTDAEGKTVAVYTALPDALHIELL
 
Nucleotide Sequence: 2487 bp     [Download]
>gi|550443072|ref|NC_022566.1|:c2399650-2397164 Klebsiella pneumoniae CG43, complete genome
ATGGATACCTCTTCAATAATTACCGGCACCACCCTTAACCGTTACCAGCTGGATATTCCTTCATGTACCG
CATCGCTGGATGTGGAAGAATTCAGTGGTGCAGAAAAGCTGAGTGAACTTTATTATTACACTATTACGTT
TACCAGCGCAGAGAAAAATATTGATGCCGCACAGCTCCTGAGCAAACCCGCCATGCTGACGATGGGCGGC
GGTGCACTGCAGCAGCTGGCGGACTGCAAACGCGTCCATGGCGTGGTGACTGCCTTCCGGCGTATCAGCA
GTTCAGAAGATCAGTCGACCTATCAGATAACTCTCCAGCCGTTTCTCTCCCTGCTGGATAAACAGTTTCG
CAGCCACCGTTTTTTCGTCAACAAATCGGTGCCGGAGGTGGTGGAGCAGGTATTGCAGGAACATCACCTG
CATGACTGGGAGTATGAGTTTAATCTCAAGCAACACTATCCGCGGCGCGAGCAAATTAATCAGTATCAGG
AGAGCGACCTGGCATTTATCCAGCGCCTGCTGGCAGAGGTGGGGATATTTTATTTCTTCACCCTGCAGGA
AGAGGCGCAGAGCGAAGTGGTTCACTTCGCCGACGCGCAGCGGGCGCTGATGTTCGATAAAACACTTCCT
GTAAACAGCCCGTCCGGGATGAGCGACAGCGGTGCGGAATCGATATGGGGTCTGAACATCACGCACAATG
TCGTAGAGGCGAACGTCACTACCCGGGATTATAACCCCCGCGATGCGCAGAGCGTTCTCCAGTCGGCAAC
AGCGGATATGACCCGGGGAAATGGGGAAGGCATCACTTACGGTGAGGTATACCACTATAAGCTTCGCCAC
CGGGAGCGTGGCGATAAAATCGACCCGCAGACGGAGACCGCCAACTTCTATGCCCGCCTCGACCATGAGC
GTTTTCTGGCTCACCAGACGCTTATTACCGCGATCAGTACTGCAGCCTGGCTGGCGCCGGCCCAGGTGCT
GACCGTTACCGACAGCCTGCCGTCGACCCTGCCTGCGCCCGTACAGGATCCGCTGTTAATCACCGGCACC
GGTTTTACCGCCAGCCGCCGGGAGGCGCTGCGTGTGTCCCTGCTGGCGGTGCCCTACAGCGAAACATTGT
GCTGGCGTCCGCCGCTGCTGCCGCGCCCGAAGGTGACTGGCACCATGACGGCGCGGGTGACCAGCGCGAA
AGCGAATGATATCTACGCCTGGCAGGATGCGTCCGGCCTGTACCGGGTGAAATTTGACCCTGACAGAGAT
GAGAAAGGGCAGGGTCAGGAAAGCATGCCGGTGCGTCTCGCCAAACCCTACGGCGGCGACGTGTACGGTT
TTCACTTCCCGCTGATCCAGGGCACGGAGGTGGCGATTGCTTTCCACGAAGGCGACCCTGACCGGCCGTA
TATTGCGCATGCGCTGCACGACTCGCGGCATGTCGATCCTGTGACGGAGAAAAACAGCACCCGCAATGTG
ATTCGTACTCCGGCCAATAATAAGCTGCGAATGGAGGACAAGCGCGGCGAGGAGCATATCAAGCTCAGCA
CCGAGTACGGCGGCAAGACGCAGCTGAACCTGGGGCATAACGTGAATGCGCAAAGGGAGTTGCGGGGCGA
GGGTGCGGAACTGCGTACGGATAAATGGGTGAGCATCCGGGGCGGTGCGGGAGTGTTTATCAGTGCGGAT
AAACAGCCTTCGGCAGGCGACAGGATGCTGGCAATGGAGGAGGCGATTGCGCAGCTTGAAAATGCCCTGG
GTATTGCGAAAAGCCTGGCGTCGGCAGCGGAATCGGCTCAGGCCCTGCCATCGGATACCGGCAACCAGCA
GACGCTGAACGATGCGCTGAAAGAGCTGGCGCAGCCGGGGATAGTGCTGAATGCGCCGCAGGGCGTGAGC
ATCAGCAGTCCGCAGGCGGTACGGTTGTCTTCGGGTAGCGCCTGCGTGGGGATTGTGTCACAGCAGAATA
CGGACATTAGTGCGCTGAAACGTTTTACGGTGGCGGCGGGAGAAGCCGTCAGCCTGCTGGCGCGAAAGGC
GGGGATGAAGCTGTTTGCGGCGAAGGGAAAGATTGAAATCCAGGCGCAGGATGATGCGCTGGAGGCGACG
GCGAAAAAGGATATCACCGTGACCAGCGTGGAAGGGCGAGTGGAAATCACGGCGGCGGAGGAACTGGTGG
TGAATTGTGCGGGAGCGTATATCAGGCTAAGTGGTGGCAATATCGAGCTGGGCTGCCCTGGGAATATTCT
GCTGAAATCGGCCAATGTGCAGAAAATGGGCGCAGCTGATTATGATGCAAACAAACCTGAGCTTCCCGTC
GGTTTCAGTGAGTTTTTTACTGCAAAAGATGAAGAGTCCGGGGAGATTTTACCTTTTACCCGGTACAGGA
TAACAACCGGTGAAGGTAAAGTATTTGAAGGCAGGACCGATGCGGAAGGTAAAACTGTTGCAGTTTATAC
TGCCCTGCCTGATGCCCTGCATATAGAATTACTTTAA