SecReT6
Protein ID: 550445181
SecReT6 ID859
T6SS typeN/A
Gene symbol-
Locus tagD364_11555
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]2401810..2402463 [-]
Productmembrane protein
NoteTssL
UniProt IDU5MFI0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-41, Aligned region: 10..205
Protein Sequence: 217 a.a.     [Download]
>gi|550445181|ref|YP_008660835.1| membrane protein [Klebsiella pneumoniae CG43]
MNTSESDLINKTFYPGWLMVSQLRCGQPVTDGEALYRQACRWVTEAREALTAGGVSEASAEQMLYAYCAL
LDESVLNRASQDDGYRRWRKDPLQARFFSTLNAGEELWERIRQLLREPTADAAVLTCFFRTLQLGFVGQY
RAEDDERREDVAQALGARVPPFSMTQEAPVVVRASRLRSGRRMYWCGWVAGIVALAALWLTFSSVLSQMV
AQIAGQG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|550443072|ref|NC_022566.1|:c2402463-2401810 Klebsiella pneumoniae CG43, complete genome
ATGAATACCTCTGAAAGCGATCTGATCAACAAAACCTTTTACCCGGGCTGGCTGATGGTCAGCCAGTTAC
GCTGCGGCCAGCCGGTGACAGATGGCGAGGCGCTCTATCGCCAGGCCTGTCGATGGGTGACCGAGGCGCG
CGAGGCGCTGACGGCGGGGGGAGTCAGTGAAGCCAGCGCTGAGCAGATGCTCTATGCCTACTGCGCGCTG
CTCGATGAGAGCGTCCTCAACCGCGCCAGTCAGGATGATGGCTACCGCAGGTGGCGCAAGGATCCGCTGC
AGGCGCGCTTTTTCAGCACTCTCAACGCCGGGGAAGAGCTCTGGGAACGGATCCGCCAGCTGCTGCGAGA
GCCCACGGCGGATGCGGCAGTGCTGACCTGCTTCTTTCGTACTTTACAGCTGGGATTTGTCGGACAGTAC
CGCGCCGAGGATGACGAACGGCGTGAGGACGTGGCGCAAGCGCTTGGCGCGCGGGTCCCGCCGTTCAGCA
TGACCCAGGAGGCGCCGGTGGTGGTTCGTGCCTCCCGGCTGCGCAGCGGACGGCGGATGTACTGGTGCGG
CTGGGTGGCTGGCATTGTGGCGCTGGCGGCGCTGTGGTTGACCTTCTCCTCCGTGCTGTCACAGATGGTG
GCGCAGATAGCAGGGCAGGGATAA