SecReT6
Protein ID: 550445182
SecReT6 ID859
T6SS typeN/A
Gene symbol-
Locus tagD364_11560
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]2402460..2403800 [-]
Producthypothetical protein
NoteTssK
UniProt IDU5MGB1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-130, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|550445182|ref|YP_008660836.1| hypothetical protein D364_11560 [Klebsiella pneumoniae CG43]
MKIFRPLWRDGAFLVPQQFQQQARWDAHVADTVSRMALAHPWGVLRAEFDASALTLSRLNATRLIVRFAD
GTLIDTELADILPPVRDVSDVMQDSVEVLLALPLLSASGGNLDDGQESARPRRWRAEQVTVQELAGHERS
ELAVLRHALTLRLSTEENAAFLTCPVARLVRDAQGQWIVDPEFIPPLLSLAASPTLVSELGELLHRLQAR
RRRLMAMRRESNARMADFAVADVSLFWLLNALNSAEPVLSELHQDPSRHPELLYRELARLAGSLLTFSLE
HHLEAIPRYRHASPEQVFPPLFALLDMLLEVSLPSRVIAIALEQGADREIWRGRLHDARLREGADFYLSV
RSSLPPHQLQSRFPQLCKAGSHDDVAEVVNIALSGIAIKPLSHVPAAIPLRLENQYFALDLSTDAARAML
EAGNCTFYSPESLGDVKLELFAVLRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|550443072|ref|NC_022566.1|:c2403800-2402460 Klebsiella pneumoniae CG43, complete genome
ATGAAGATTTTCCGCCCATTATGGCGCGACGGGGCTTTTCTGGTCCCGCAGCAGTTTCAGCAACAGGCCC
GCTGGGACGCGCACGTCGCCGATACGGTCTCCCGCATGGCGCTCGCCCACCCGTGGGGGGTATTGCGCGC
GGAGTTTGACGCGAGCGCGCTCACCCTTTCCCGGCTCAACGCTACCCGGCTGATCGTGCGTTTCGCCGAC
GGAACGCTGATTGACACCGAGCTAGCGGATATTTTGCCACCGGTCCGCGATGTATCGGACGTGATGCAGG
ACAGCGTGGAGGTTCTGCTCGCTCTGCCGCTGCTCAGCGCCAGCGGCGGCAATCTTGATGACGGCCAGGA
GAGCGCCCGCCCGCGCCGCTGGCGCGCCGAGCAGGTGACCGTCCAGGAGCTGGCCGGCCATGAACGCAGC
GAGCTGGCCGTTCTGCGGCACGCGCTAACGCTGCGTCTCTCCACCGAGGAAAATGCAGCCTTCCTCACCT
GCCCGGTAGCGCGTCTGGTGCGCGACGCCCAGGGGCAGTGGATCGTTGACCCGGAATTCATCCCGCCGCT
GCTGTCGCTGGCGGCAAGCCCGACGCTGGTTAGCGAGCTGGGCGAGCTGTTACATCGCCTGCAGGCCCGA
CGCAGACGCCTGATGGCCATGCGTCGTGAAAGCAATGCGCGGATGGCTGATTTTGCCGTGGCGGATGTTT
CCCTGTTCTGGCTGCTCAACGCGCTGAACAGCGCTGAACCGGTGCTCAGCGAGCTGCATCAGGACCCTTC
GCGCCATCCGGAGCTGCTCTATCGCGAACTGGCCAGGCTGGCCGGCAGTCTGCTGACTTTCTCCCTTGAA
CATCATCTGGAAGCAATCCCCCGCTACCGACATGCCTCGCCAGAGCAGGTATTCCCGCCGCTGTTTGCCC
TGCTGGATATGCTGCTCGAAGTCAGCCTGCCCTCAAGGGTGATCGCCATCGCTCTGGAGCAGGGCGCCGA
CCGGGAGATCTGGCGGGGCAGGCTACACGATGCGCGGCTGCGCGAGGGGGCGGATTTTTATCTGTCGGTG
CGCTCTTCACTCCCCCCTCACCAGCTACAGAGCCGCTTTCCGCAGCTCTGTAAGGCGGGTAGCCATGATG
ATGTCGCCGAGGTCGTCAATATTGCCCTCAGCGGCATCGCGATCAAACCGCTGAGCCATGTGCCGGCGGC
CATTCCGCTACGTCTGGAAAACCAATATTTCGCTCTGGATCTCTCCACCGACGCCGCCCGCGCGATGCTG
GAGGCCGGCAACTGCACCTTCTATAGCCCGGAATCGCTTGGCGACGTGAAACTTGAACTCTTTGCGGTAC
TGCGCTCATGA