SecReT6
Protein ID: 550447591
SecReT6 ID858
T6SS typei2
Gene symbol-
Locus tagD364_06945
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]1475943..1477535 [+]
Producttype VI secretion protein
NoteTssA
UniProt IDU5MM94
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-21, Aligned region: 66..126
Protein Sequence: 530 a.a.     [Download]
>gi|550447591|ref|YP_008659930.1| type VI secretion protein [Klebsiella pneumoniae CG43]
MSILQNLVAASQLDESVLRQQARSRQAQWQSWLAPVSDAQPTGDDPGYDDDFQRIRDEVNKISGVDTELI
CQLAEKLLTQTCKDLRVITFYVWARLQRDGETGLAEGVTLLAAMLERFGAMLHPQRERSCKSALEWLGSR
RMSDSLSLYPEVDMTTMQVIIGALLLAEATFSGLAEASRPDLSGLYQILENRLVQSGGAHSLVPQTSREE
HDLLPQHTDTAPVMHTVTSGRDLLDQAKVLAKYLRECPGGWLAGHHLMKSVRWDTLTELPPLDASGRTRL
LPPKPESKAHLKRLYLQKSWSELLEHTDTLLAQGVNHLWLDVQWYAWQALLKLDADSVRADILCRDMKGL
LARLPGLETLAFNDGTPFADEVTLNWLNERVLDEMAGWQDEPVMAATTADEVLSLEPEVLTRADDEGIES
ALNWLQAQPGYTTSRNRWLMRLLMARVSEQYGKNEMALHLLAELDSRAREMTLEQWKPELIFEVKARRLR
LLRGKAGRSEAEKNRLLPEMESLLAGLIALDPARAAVLCA
 
Nucleotide Sequence: 1593 bp     [Download]
>gi|550443072|ref|NC_022566.1|:1475943-1477535 Klebsiella pneumoniae CG43, complete genome
ATGAGCATTTTACAAAATTTGGTTGCCGCTAGTCAGTTGGATGAAAGCGTACTGCGCCAGCAGGCCCGGT
CACGTCAGGCGCAGTGGCAGTCCTGGCTTGCGCCAGTCAGTGACGCCCAACCAACCGGGGACGATCCGGG
CTATGACGATGATTTTCAGCGTATCCGCGATGAGGTCAATAAGATCTCCGGCGTCGATACCGAACTGATT
TGCCAGCTGGCAGAAAAACTGCTGACTCAGACCTGCAAGGATCTGCGCGTGATCACCTTTTACGTGTGGG
CGCGTCTGCAGCGGGATGGTGAAACCGGTCTGGCGGAGGGCGTTACGCTGCTGGCGGCAATGCTTGAGCG
GTTTGGGGCTATGCTCCATCCCCAGCGTGAACGTAGCTGTAAATCAGCGCTGGAATGGCTTGGCAGTCGC
CGGATGTCGGACAGTCTGTCTCTTTATCCGGAAGTCGACATGACCACTATGCAGGTCATTATCGGGGCGT
TATTGCTGGCGGAAGCCACTTTTTCCGGCTTGGCTGAAGCATCTCGCCCCGATCTTTCCGGGCTATATCA
GATACTGGAGAACCGCCTGGTGCAAAGCGGCGGAGCCCACAGTCTGGTGCCGCAGACCAGCCGCGAAGAA
CACGATCTGCTACCCCAACATACGGACACCGCACCGGTAATGCATACCGTCACGTCAGGTCGTGATTTGC
TCGATCAGGCTAAGGTGCTGGCGAAATATCTGCGCGAGTGTCCCGGCGGATGGCTGGCAGGTCATCATCT
GATGAAGAGTGTGCGTTGGGATACGTTAACGGAGTTACCGCCGCTGGATGCCTCCGGCCGGACACGGCTA
TTGCCTCCCAAGCCTGAGAGTAAAGCCCATCTTAAGCGGTTGTATTTACAGAAAAGCTGGTCGGAACTGC
TGGAGCATACGGACACGCTGTTGGCGCAAGGCGTCAACCATCTGTGGCTGGATGTGCAGTGGTACGCCTG
GCAGGCGCTGCTGAAACTGGATGCTGACAGTGTACGGGCCGATATCCTGTGCCGGGATATGAAAGGGCTA
TTGGCTCGTCTGCCGGGGCTGGAAACCCTGGCGTTTAACGATGGTACGCCATTCGCCGATGAAGTGACGC
TCAACTGGCTTAACGAACGTGTCCTGGATGAGATGGCCGGATGGCAAGATGAGCCGGTAATGGCGGCGAC
CACCGCTGATGAGGTGCTGTCGCTGGAGCCAGAAGTGCTCACCCGCGCGGACGATGAAGGTATTGAGTCG
GCGCTGAACTGGTTACAGGCGCAGCCGGGCTATACCACCAGCCGCAATCGGTGGCTGATGCGCTTACTGA
TGGCGCGGGTCAGCGAGCAGTACGGAAAAAATGAAATGGCGCTGCATCTGCTGGCGGAACTCGACAGCCG
CGCCCGGGAAATGACGCTCGAACAATGGAAGCCGGAGCTTATCTTTGAGGTCAAAGCCCGCCGACTCCGG
CTGCTCAGAGGCAAGGCCGGGCGCAGTGAGGCAGAAAAAAATCGCTTGCTGCCAGAAATGGAGTCATTGC
TTGCCGGGCTCATCGCTCTGGATCCTGCTCGCGCCGCGGTGCTGTGCGCATAA