SecReT6
Protein ID: 550899681
SecReT6 ID860
T6SS typei3
Gene symbolsciC
Locus tagDT104_02661
StrainSalmonella enterica subsp. enterica serovar Typhimurium DT104
Repliconchromosome [GenBank: NC_022569] [Browse all T6SS(s) in this replicon]
Location [Strand]306722..308605 [-]
Productuncharacterized type IV secretion system SciC protein
NoteTssF
UniProt IDT2K296
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-210, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|550899681|ref|YP_008668773.1| uncharacterized type IV secretion system SciC protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT104]
MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPYVERMIEAFSFLSARTQLKIDAEFPR
FTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDLAKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWP
LSIEEVRLTAAPPDMPALHRYLPPNIHVAGALRITLRTFGELTFSELAGPARLPFYLCGEERIASHLFEL
LHTSAVATLAGEPGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTG
LSAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSVTEQHLVVDRT
RPLDYEVFSVQEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRREPRRSSENARRYGTRTPYTGSE
VFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRNGRDDLTVDAAIPVAGVGLIRPPRPPQPPLAER
EMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLV
YGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGHVMTWPVRTGQRGSV
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|550899431|ref|NC_022569.1|:c308605-306722 Salmonella enterica subsp. enterica serovar Typhimurium DT104 main chromosome, complete genome
ATGGATCCACGGCTACTGGAGTATTACAACCGCGAACTGAGCTACCTGCGGGAGACCGGTGCTGAGTTCG
CCACCCTCCATCCCAAAATTGCCGCCCGACTGGGGATGCAGGGAACCGATATTGCCGACCCGTATGTGGA
ACGCATGATCGAGGCGTTCAGCTTTCTGAGCGCCCGCACTCAGCTAAAAATTGACGCCGAGTTTCCCCGC
TTCACACAGCGGTTACTGGAAGTCGTCAGCCCCAATTACGTCACCCCCACGCCATCGATGGCAGTGGTAA
AGCTGTATCCCGATACGCAGGAAGGCGACCTGGCGAAAGGGGTCACCGTGCCGCGCGATACCGCGTTCGT
TTCCCCCATCCCGGAAGGCGAAAATACCGCCTGCCAGTTTCGCAGCAGCCAGGACGTCACGCTGTGGCCG
CTGTCCATCGAGGAGGTACGCCTGACCGCCGCGCCGCCGGATATGCCCGCCCTGCACCGCTATCTGCCGC
CTAATATTCATGTCGCCGGGGCATTGCGCATCACCCTGCGAACCTTCGGGGAACTGACTTTCAGCGAGCT
GGCCGGTCCGGCACGGCTGCCCTTTTACCTCTGCGGCGAAGAACGCATTGCGTCACACCTGTTTGAGCTG
CTACATACCAGCGCCGTCGCCACACTGGCCGGTGAACCCGGTCACTTTGACGGCGAACTGAATGTGAATC
TTCAACACCCGGTGGCGCACGAAGGGCTGGAGCCAGGGCAGGGGCTGCTACCGCTCGCCTGGAACGTGTT
TCACGGCCATAATCTGCTGCATGAATTTTTCGCCTGTCCGGAACGGTTTTACTTCTTCACCCCGACCGGA
TTGTCTGCCGGGTTACAAAAGGTGCAGGGCAATGTGGCGGAAATTGTCATACTGCTTAACCGCCTGCCGC
CGGACTGGCTGATTCATCAGACGGACGCTGCACAGTTCAGCCTGTTCTGTACGCCGGTGATCAACCTGTT
TCCTCGCACCACCACCCGGATTGAAGTCACTCACAGCGTGACGGAACAGCATCTGGTGGTGGATCGTACC
CGTCCGCTGGATTACGAGGTGTTTTCTGTTCAGGAAGTCGAAGGCCTGGAAGCGGAAACCACACGGAAGA
TGATTTTTCGTCCGCTGTATCACACCCGTAATAATGACGAAGGCAACCACGGGCGTTATTTTTCACTGCG
TCGTGAACCGCGCCGCTCGTCAGAAAACGCCCGCCGCTATGGCACCCGAACCCCCTATACCGGCTCGGAA
GTCTTCCTCTCGCTGGTTGATCAGCATGAAGCGCCCTACCCGGAAAATCTGCGCCATATCACCGTCACGG
CAATGGTGACTAACCGCGATCTGCCCTGCCTTATTCCACGTAATGGCCGGGATGATCTGACCGTAGATGC
GGCGATTCCGGTGGCGGGCGTGGGTCTTATCAGACCGCCGCGCCCGCCGCAGCCGCCGCTGGCTGAACGC
GAAATGGCCTGGCGGCTGATCCGGCAGTTGTCGTTTAATTATCTGCCGCTGGCCGATCTGGATCACCGCA
CCGGCGGCCAGGCGCTGCGCGATCTGCTGAATCTGTTTATCCCGGCTCACGACAGCCCGCAGTCGCGCCA
GGTGCGCAGCCTGATTGGCTGCAAAACCACCCCGGTGACCCGCCGCCTGCCCGGCTCCGGCCTGTTGGTC
TATGGCCGGGGCGTCAGTTGCGAACTGACCGTGGACGAAGAAGGATTTTCCGGTATCAGTCCTTACCTGT
TCGGTCTGGTGCTGGAACACTATATTGCCCGCCATGTTTCCATTAATACCTTCTCGCAGATGACGCTGCA
CTCGATGCAACGCGGGCATGTCATGACCTGGCCGGTCAGAACCGGGCAACGGGGGAGCGTATGA