SecReT6
Protein ID: 550899692
SecReT6 ID860
T6SS typei3
Gene symbol-
Locus tagDT104_02771
StrainSalmonella enterica subsp. enterica serovar Typhimurium DT104
Repliconchromosome [GenBank: NC_022569] [Browse all T6SS(s) in this replicon]
Location [Strand]318152..318535 [+]
Productputative periplasmic protein
NoteSTM0278 (i)
UniProt IDT2K352
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|550899692|ref|YP_008668784.1| putative periplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT104]
MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYL
EYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
 
Nucleotide Sequence: 384 bp     [Download]
>gi|550899431|ref|NC_022569.1|:318152-318535 Salmonella enterica subsp. enterica serovar Typhimurium DT104 main chromosome, complete genome
GTGGATACTGCCGTGAAATGGTTAATATTAGTTACTTTCAGCATAAGTGGAATGCTGGTATGGCAGCCAT
CCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAAAAAATTGGGCGCTGAGTCA
TTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGCTACGGCCAGTGCTTACCTT
GAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCGAAAAAATATTCAGGGTTGA
AATATAACGGTTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATTTTATCCATGACAGGGAATT
AAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA