SecReT6
Protein ID: 550899693
SecReT6 ID860
T6SS typei3
Gene symbolsciM
Locus tagDT104_02781
StrainSalmonella enterica subsp. enterica serovar Typhimurium DT104
Repliconchromosome [GenBank: NC_022569] [Browse all T6SS(s) in this replicon]
Location [Strand]318678..319163 [+]
Producttype IV secretion system hemolysin-coregulated SciM protein
NoteTssD
UniProt IDT2K2A0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-42, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|550899693|ref|YP_008668785.1| type IV secretion system hemolysin-coregulated SciM protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT104]
MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLSFEHYIDRASPNLF
KYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIASRESIELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|550899431|ref|NC_022569.1|:318678-319163 Salmonella enterica subsp. enterica serovar Typhimurium DT104 main chromosome, complete genome
ATGTCTTATGACATTTTTCTGAAAATTGACGGCATTGACGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGTCTCGG
TTCCGGTAAGGTCTCCGTCACTAATCTTTCATTTGAACATTACATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCTCTTCCGGTAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTACACTTTCACAGATCTGATTATTGCAATGGTATCGCCCAGCGGAAGCCAGGGAGG
GGAAATTGCGTCTCGCGAATCAATTGAACTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGTGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA