SecReT6
Protein ID: 550899704
SecReT6 ID860
T6SS typei3
Gene symbolvgrG
Locus tagDT104_02881
StrainSalmonella enterica subsp. enterica serovar Typhimurium DT104
Repliconchromosome [GenBank: NC_022569] [Browse all T6SS(s) in this replicon]
Location [Strand]329872..332061 [+]
ProductVgrG protein
NoteTssI
UniProt IDT2K378
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-79, Aligned region: 121..429
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 467..559
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 663..685
Protein Sequence: 729 a.a.     [Download]
>gi|550899704|ref|YP_008668796.1| VgrG protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT104]
MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAESAVEQAAGSLFGALPEPSGLVKAAVAA
AQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLN
LGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWVKLLTHTSDY
KAFQNKTVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTL
VLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRET
GHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVK
VQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWG
LPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHAEKDLNTTVKNNETHTVMVDRTKTIIKNETN
SIGEDRNTTVTKNDGLSVKLAQTINIGTTYRLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVM
QLIGKGIDMNPDGGTAVTADDIAPLLTSE
 
Nucleotide Sequence: 2190 bp     [Download]
>gi|550899431|ref|NC_022569.1|:329872-332061 Salmonella enterica subsp. enterica serovar Typhimurium DT104 main chromosome, complete genome
ATGAGTTTTGTATCCACAAATAATAAATCCGGTATGGGAGGGCTGACGACAACCACGCCGCCGATAACCG
GAGAAAGTGGCGGTGTCACCGCAGATTCAGTCGCCGGAAGCGTGGCAGATGCGGCGGAATCCGCCGTGGA
ACAGGCTGCGGGATCGCTATTTGGCGCATTGCCGGAGCCATCAGGACTGGTGAAAGCCGCGGTAGCAGCG
GCGCAGGCTGCCGCCGCCGCAGGTATGGCGCAGGATGCGGTATCGGCCATCGTCTCTGCTGTTGCAGGCG
GGCCGGGGGCGCATAATGTGACGGTCAGCGGCAGCGCCGTACCGCCGGGCGCATTACTGTTCGCCAGCCT
GGACGGCGGCGAAACATTAAGTGAACTGTTCAGCTATGTGGTACAGCTAAAAACGCCCGACACCCTGAAT
CTGGGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAGATCTGTGCGTCAACA
TCGAACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGTGGTGGGCCATGA
AGGGCGTTCGGTTACCTATGAGCTGCGTATGGAGCCGTGGGTAAAACTGCTGACCCATACCAGCGACTAC
AAAGCATTCCAGAATAAAACCGTGGTGGATATTCTGGATGAGGTTCTGGCGGAATATCCCTACCCGGTGG
AAAAGCGGCTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGAAACTGATTTTGATTT
TCTTCAGCGACTGATGCAGGAGTGGGGCATCTACTGGTGGTTTGAGCACAGCGAGGACAGCCACACGCTG
GTGCTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGTGGCACCAGGAAG
GGCTGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGCCTGCGGACTGGACAGTGGGT
GCTGGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACCGTGGCAAACCCGCGTGAAACC
GGTCATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAGGCGAGATGCTGA
CGCGCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAATATCCGCACACT
CATGACCGGTTATACCTTCACGCTGGAAAACTATCCCACCGCCGAAGTCAATCAGGAATATCTGCTGATG
CAGACCTTGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGGACCAGCACTTTACCTTTTCCACCC
GTTTTGAACTGCACCCCACCCGCGAGGTGTTCCGCCCGCAGCGGACGGTGAGCAAACCCCACACCAAAGG
GCCGCAGAGCGCCATCGTCACCGGCCCGGCGGGCCAGGAAATCTGGACGGATCAGTACGGGCGGGTAAAG
GTACAGTTTGGTTGGGATCGCTACGGCAAAATGGATGAAAACAGCTCCTGCTGGATACGCGTCAGCTACC
CGTGGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCTGGTGGATTTCAA
AAACGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACCATGCCGCCGTGGGGA
CTGCCGGGAATGGCGTCGCAGAGCGGGATCTTCAGCCACTCGCTGTATGGCGGGCCAACGAACGGCAACA
TGCTGCGTTTTGACGACAAAACGGGCGCGGAGGAAGTGAAGTTCCACGCGGAAAAAGATCTCAACACCAC
GGTGAAGAATAATGAAACGCATACGGTTATGGTGGATCGCACTAAAACCATTATTAAAAATGAAACCAAC
AGTATTGGTGAGGACAGAAACACCACGGTAACGAAGAATGACGGCCTTTCCGTAAAACTGGCGCAGACGA
TCAATATCGGCACCACTTATCGTTTAGATGTTGGCGATCAATTCACGCTTCGCTGCGGCAATGCGGCGCT
TGTTTTACATAAGGACGGCTCCATTGAGTTTTGTGGCAAGCAACTGATGTTACATACCAGCGATGTCATG
CAACTGATTGGTAAAGGTATTGATATGAACCCGGATGGCGGCACAGCCGTAACCGCCGATGATATTGCCC
CCCTTCTCACCTCTGAGTGA