SecReT6
Protein ID: 550899706
SecReT6 ID860
T6SS typei3
Gene symbol-
Locus tagDT104_02901
StrainSalmonella enterica subsp. enterica serovar Typhimurium DT104
Repliconchromosome [GenBank: NC_022569] [Browse all T6SS(s) in this replicon]
Location [Strand]332550..334076 [+]
Productrhs1 protein flags: fragment
NotePAAR
UniProt IDT2K2B5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 7.40E-16, Aligned region: 71..140
RHS_repeat [PF05593], Evalue: 2.40E-05, Aligned region: 384..425
RHS_repeat [PF05593], Evalue: 2.40E-05, Aligned region: 410..445
RHS_repeat [PF05593], Evalue: 2.40E-05, Aligned region: 460..468
Protein Sequence: 508 a.a.     [Download]
>gi|550899706|ref|YP_008668798.1| rhs1 protein flags: fragment [Salmonella enterica subsp. enterica serovar Typhimurium str. DT104]
MYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLAGLILGFMADQIASGVLQLGEAIGRS
IHHTAGKILTGSENVSTNSRPAARAVLSTVKCDNHIAEKRIAQGSENIYINSQPAARKDDHTECDAVIED
GSPNVFLGGGTQTVLEISSEIPDWLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGELV
GMAVGEAISGLFSNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGRGWRLNWETSLRDD
DEHITLTGVQGRELRYPKTMLTPGHQIFDPEEQLYLSRLHDGRYVLHYTDRSYYVFGDFDSDGMAYLLFM
ETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQGGTRGNLVEYRYDDNGQLTGVV
NRAGTQVRQFAYENGLMTAHSNATGFTCRYRWQELDGAPRVTEHDTSDGGGRNAGVGGVYQGVWRKCGGH
QQQRGVLSPAAAAAGAVF
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|550899431|ref|NC_022569.1|:332550-334076 Salmonella enterica subsp. enterica serovar Typhimurium DT104 main chromosome, complete genome
ATGTATGAAGCAGCCCGTGTGGATGATCCTATCTACCACACCAGCGCGCTCGCCGGGTTTCTTATCGGCG
CTATCATCGGCATCGCCATTATCGCGCTTGCCGCCTTTGCCTTCTTTAGCTGCGGTTTTCTTGCCGGGCT
GATTCTGGGTTTTATGGCCGATCAAATAGCCTCCGGGGTATTGCAACTGGGCGAGGCCATCGGGCGCTCC
ATCCACCACACGGCAGGAAAAATCCTCACCGGTTCGGAGAATGTCAGCACCAACAGTCGCCCGGCGGCGC
GCGCGGTACTGAGTACGGTGAAATGCGATAACCATATCGCAGAAAAACGCATCGCCCAAGGGTCGGAAAA
TATCTACATCAACAGCCAGCCCGCCGCCCGTAAGGATGACCACACCGAATGCGACGCGGTGATTGAAGAC
GGTTCGCCGAATGTGTTTCTCGGCGGCGGCACACAGACGGTACTGGAAATCAGTTCTGAAATTCCGGACT
GGCTGCGCAAGGTGGTGGATGTATTGTTTGTCGTGGCGAGTCTGCTCGGCGGGCTGGCCGGGGCGTGGCG
GCAGGCGGCAAAGCTGGGGACGAAATTTGGCACTAAATGTGCCGCTAAGTTTATCGGCGGGGAGCTTGTC
GGGATGGCCGTGGGTGAGGCTATCAGCGGGCTGTTCAGCAATCCGGTGGATGTGACCACCGGGCAGAAAA
TCCTGCTGCCGGAAACGGACTTCACCCTGCCCGGTCGCCTGCCGGTCACCTGCTCGCGTTTTTACGCCAG
CCACCTGGAAACTGTGGGACTGTTGGGACGGGGCTGGCGGCTGAACTGGGAAACCAGCCTGCGCGATGAC
GATGAACACATCACGCTGACCGGCGTACAGGGGCGGGAACTGCGTTACCCGAAAACGATGCTGACGCCCG
GCCACCAGATATTTGACCCGGAAGAACAGTTATACCTCAGCCGCCTGCATGACGGGCGTTACGTGCTGCA
TTACACCGATCGCAGCTATTACGTATTTGGTGATTTTGACAGTGACGGCATGGCATACCTGCTGTTTATG
GAGACGCCGCACCGCCAGCGCATTGTCTTCGGGCACGAAGGAGGCAGACTGGTACGGATAGCCTCCAGCA
GCGGGCATCACCTGTTACTGCACCGCACACAGACCCCGGCAGGGGAGCGGCTGTCGCGAATTGAACTGGT
GCAGGGCGGCACCCGTGGCAATCTGGTGGAGTACCGGTATGACGATAACGGTCAACTGACCGGCGTGGTG
AACCGGGCGGGAACGCAGGTGCGTCAGTTTGCTTATGAAAACGGGCTGATGACGGCGCACAGCAATGCGA
CGGGGTTCACCTGCCGCTACCGCTGGCAGGAACTCGACGGCGCGCCGCGCGTGACGGAGCACGACACCAG
TGACGGCGGCGGACGGAACGCTGGTGTGGGCGGGGTATATCAAGGGGTTTGGAGAAAATGCGGCGGACAT
CAGCAACAGCGGGGCGTACTTTCACCAGCCGCTGCGGCTGCCGGGGCAGTATTTTGA