SecReT6
Protein ID: 551595758
SecReT6 ID861
T6SS typei1
Gene symbol-
Locus tagDESAM_21878
StrainDesulfovibrio hydrothermalis str. sp nov AM13
Repliconchromosome [GenBank: NC_022579] [Browse all T6SS(s) in this replicon]
Location [Strand]2266880..2268496 [+]
ProductType VI secretion-associated protein, VC_A0119 family
NoteTssA
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-18, Aligned region: 47..107
ImpA-rel_N [PF06812], Evalue: 1.10E-18, Aligned region: 329..347
Protein Sequence: 538 a.a.     [Download]
>gi|551595758|ref|YP_008685051.1| Type VI secretion-associated protein, VC_A0119 family [Desulfovibrio hydrothermalis]
MELLDLGKKPVSEASPAGADARYEPEYDELQQEVDKLTSVTAGGVIDWKHVVKLCSVILFKKSKDIKVAS
YLGVGLINLKGVEGLSAGAQILSDLVSNYWDTMYPAKKRMRGRFNAVSWWSDKAEEFLGSYEGEDLTQET
VDLLVRRIKKLDEALADKSEDAPVLNSLIGYADRLPVQAAAEPSPVQGLDEKASPEPSDVQAETPTGDAA
STSVPSSPASPAQAGSAAVLSSPVGNINSHEDYLKELNSGLTGLSGVADYLLANDIAGAPGYRLRRISAW
LPVSSPPPSENGKTMIPPPDSSVKESIVRQLENRDFAGAIQAAESRVGQYLFWLDLSRLTVDGLDGLGGD
YLEAKYGLELETVMFVKRMSGLESMTFADGTPFADSKTKAWLRSLDHEKTSGLGSGVEQDSVSEKVYADA
VKLVKNKKIFDAVTLLHGSLKSSPSGRERFLLRLGMVRLLSDVGQSALAHVHVEEVLGQIKKFGLEEWAP
DLALNGLMTVYEALISEGGDEAVVLAEKTLQRISRIGPAEALKINGFN
 
Nucleotide Sequence: 1617 bp     [Download]
>gi|551593593|ref|NC_022579.1|:2266880-2268496 Desulfovibrio hydrothermalis str. sp nov AM13 chromosome, complete genome
ATGGAGCTTCTTGATCTTGGAAAAAAGCCGGTAAGTGAGGCCAGCCCGGCGGGTGCTGATGCCCGATATG
AGCCGGAATATGATGAGCTTCAGCAGGAAGTTGATAAATTAACCAGCGTTACCGCCGGCGGGGTTATTGA
CTGGAAACATGTAGTCAAACTTTGCTCTGTCATTCTTTTTAAAAAGTCTAAAGATATAAAAGTAGCATCT
TACCTTGGAGTGGGGCTGATCAATCTTAAAGGGGTTGAGGGGCTTTCGGCCGGTGCACAGATTTTAAGCG
ACCTCGTGAGTAATTACTGGGATACCATGTATCCGGCAAAAAAACGGATGCGGGGCAGGTTTAATGCTGT
AAGCTGGTGGTCTGATAAAGCTGAAGAATTTCTTGGAAGTTATGAAGGGGAGGATCTTACGCAGGAGACA
GTTGATCTTCTTGTCCGGCGCATCAAAAAGTTGGACGAAGCATTAGCTGATAAGTCAGAAGATGCCCCTG
TCCTTAACAGCCTGATTGGTTATGCAGATCGTCTGCCTGTTCAGGCTGCTGCTGAGCCTTCACCTGTACA
GGGCTTGGATGAAAAGGCTTCACCTGAGCCGTCGGACGTCCAGGCTGAAACCCCGACGGGAGATGCTGCT
TCGACCTCCGTCCCTTCTTCCCCCGCAAGTCCTGCTCAGGCGGGAAGTGCAGCTGTTCTTTCGTCTCCTG
TCGGTAATATCAATTCCCATGAGGATTATCTTAAAGAACTTAACTCAGGACTGACCGGTCTTTCCGGAGT
CGCTGATTATTTGCTTGCCAATGATATTGCCGGAGCACCGGGATACCGGCTCAGACGGATTTCCGCATGG
CTTCCTGTCTCGTCTCCGCCTCCTTCTGAAAACGGGAAAACTATGATTCCCCCGCCTGACAGTTCTGTTA
AGGAATCTATTGTCCGCCAATTGGAAAATCGCGATTTTGCAGGAGCTATTCAGGCGGCTGAATCCAGAGT
GGGGCAGTATCTTTTCTGGCTTGATCTAAGCCGTCTTACCGTGGATGGGCTTGATGGTCTGGGTGGAGAC
TATCTTGAAGCTAAGTATGGTCTTGAACTTGAGACAGTGATGTTTGTCAAACGGATGTCCGGTTTGGAGT
CCATGACTTTCGCAGATGGCACTCCTTTTGCCGATTCCAAAACCAAAGCATGGCTGAGGTCACTGGATCA
TGAGAAAACTTCCGGCCTCGGATCTGGGGTTGAGCAGGATTCAGTATCTGAAAAAGTTTATGCTGATGCT
GTGAAATTAGTAAAAAATAAAAAAATATTTGACGCAGTCACCCTCCTTCATGGTAGTTTAAAAAGTAGTC
CCTCTGGTCGAGAGAGATTCCTGCTTCGGCTGGGTATGGTGCGTCTTCTTTCTGATGTGGGCCAGAGTGC
TCTGGCGCATGTGCATGTGGAGGAGGTTCTGGGGCAGATTAAAAAGTTCGGCCTTGAAGAATGGGCGCCG
GATCTTGCTTTAAACGGTTTAATGACCGTGTATGAGGCTTTGATTTCAGAAGGCGGTGATGAAGCCGTGG
TGCTGGCTGAAAAGACGTTGCAACGCATCAGTCGGATAGGTCCTGCTGAGGCGTTAAAGATAAATGGTTT
TAATTGA