SecReT6
Protein ID: 551595759
SecReT6 ID861
T6SS typei1
Gene symbol-
Locus tagDESAM_21879
StrainDesulfovibrio hydrothermalis str. sp nov AM13
Repliconchromosome [GenBank: NC_022579] [Browse all T6SS(s) in this replicon]
Location [Strand]2268541..2269023 [+]
ProductType VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.60E-57, Aligned region: 5..158
Protein Sequence: 160 a.a.     [Download]
>gi|551595759|ref|YP_008685052.1| Type VI secretion protein, VC_A0107 family [Desulfovibrio hydrothermalis]
MAKEGSVAPKERVNIVYKPETGNAKEEVELPLKLLVIGDFSQKDDDSMVEDRDPVNIDKDNFNEVLKAQD
LELTLGVDNKLTDEADAQMAVNLKFESLKDFDPDRIIKQVPELQKLMELREALKALKSPLSNVPEFRKKV
QSLVKDAGARERLLKELGIE
 
Nucleotide Sequence: 483 bp     [Download]
>gi|551593593|ref|NC_022579.1|:2268541-2269023 Desulfovibrio hydrothermalis str. sp nov AM13 chromosome, complete genome
ATGGCAAAAGAAGGCTCAGTAGCCCCCAAAGAAAGGGTGAACATAGTTTATAAACCGGAAACAGGTAACG
CTAAAGAAGAAGTTGAACTTCCTCTTAAGCTCTTGGTCATTGGGGATTTCTCCCAAAAGGATGATGACAG
CATGGTCGAGGACCGTGATCCCGTTAACATTGATAAAGATAATTTTAACGAGGTGCTTAAAGCTCAGGAT
CTGGAGCTTACGCTTGGAGTTGATAATAAACTCACTGATGAAGCTGACGCACAGATGGCTGTGAATCTTA
AGTTTGAAAGTCTAAAGGATTTTGACCCTGACCGGATAATTAAACAGGTTCCTGAATTGCAGAAGCTTAT
GGAACTGCGTGAAGCTTTAAAGGCACTTAAAAGTCCGCTCTCCAACGTGCCGGAGTTCAGGAAGAAGGTG
CAGAGTCTGGTTAAGGATGCCGGAGCACGTGAACGTCTGCTTAAAGAACTTGGAATCGAGTAA