SecReT6
Protein ID: 551595761
SecReT6 ID861
T6SS typei1
Gene symbolhcpC
Locus tagDESAM_21881
StrainDesulfovibrio hydrothermalis str. sp nov AM13
Repliconchromosome [GenBank: NC_022579] [Browse all T6SS(s) in this replicon]
Location [Strand]2270607..2271089 [+]
ProductMajor exported protein
NoteTssD
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-37, Aligned region: 6..146
Protein Sequence: 160 a.a.     [Download]
>gi|551595761|ref|YP_008685054.1| Major exported protein [Desulfovibrio hydrothermalis]
MALTSYMKITGKTQGQIKGDCTQTGDKKDSMLVYAVEHNVEIPKDTHTGLPTGQRIHKPFEVTKHVDNAS
PKLAQACCKGEQLTVEIDYYHIDPTGIEKKYYTVKMEEAIIVNLKHYKPITFVEENKAFHDMEEVSFTYS
KITWTYADGNIEYTDDWKSS
 
Nucleotide Sequence: 483 bp     [Download]
>gi|551593593|ref|NC_022579.1|:2270607-2271089 Desulfovibrio hydrothermalis str. sp nov AM13 chromosome, complete genome
ATGGCTTTAACTTCGTACATGAAAATAACAGGAAAGACTCAGGGACAGATTAAAGGCGATTGTACTCAAA
CTGGCGATAAGAAAGACTCCATGCTTGTCTATGCCGTTGAGCATAATGTTGAAATCCCCAAAGATACCCA
CACCGGCCTGCCGACAGGGCAGCGTATTCATAAGCCTTTCGAGGTTACCAAGCATGTGGATAATGCTTCT
CCGAAGCTGGCTCAGGCTTGCTGTAAAGGCGAGCAGCTGACGGTTGAAATTGACTACTATCATATCGATC
CCACTGGTATTGAAAAGAAATACTACACAGTCAAAATGGAAGAGGCGATCATCGTCAACCTCAAACATTA
TAAACCGATAACTTTTGTGGAAGAAAATAAAGCTTTTCATGACATGGAGGAAGTAAGCTTTACCTATTCC
AAAATTACCTGGACCTACGCGGACGGTAATATCGAATACACTGACGACTGGAAATCAAGCTAA