SecReT6
Protein ID: 551595762
SecReT6 ID861
T6SS typei1
Gene symbol-
Locus tagDESAM_21882
StrainDesulfovibrio hydrothermalis str. sp nov AM13
Repliconchromosome [GenBank: NC_022579] [Browse all T6SS(s) in this replicon]
Location [Strand]2271142..2271561 [+]
ProductType VI secretion system lysozyme-related protein
NoteTssE
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-17, Aligned region: 27..120
Protein Sequence: 139 a.a.     [Download]
>gi|551595762|ref|YP_008685055.1| Type VI secretion system lysozyme-related protein [Desulfovibrio hydrothermalis]
MNEQRLLERIRYMEQEPDSRDTAEPGQVVKSILDYLRMILNTRQGNAQIAPDFGVPDFTSMIGSTGLDAV
RDIEESMTEVILKYEPRLENVKIEFIPEEDMPLSLQFKLQAKLALDDQEVPVVFETVLDPDGRIMVLDS
 
Nucleotide Sequence: 420 bp     [Download]
>gi|551593593|ref|NC_022579.1|:2271142-2271561 Desulfovibrio hydrothermalis str. sp nov AM13 chromosome, complete genome
TTGAACGAGCAGCGGTTACTTGAGCGCATACGGTATATGGAACAGGAACCGGACAGTCGCGATACGGCTG
AACCGGGGCAGGTTGTCAAATCCATACTTGATTACTTGCGCATGATCCTTAATACGCGGCAGGGCAATGC
TCAGATTGCCCCTGATTTCGGAGTGCCGGATTTTACTTCTATGATCGGTTCGACCGGCCTTGATGCCGTA
CGCGATATTGAGGAATCAATGACCGAGGTTATATTGAAGTACGAACCACGGCTGGAAAATGTGAAAATTG
AATTTATTCCCGAAGAAGACATGCCCCTGTCTCTCCAGTTCAAGCTTCAAGCTAAGCTTGCACTTGATGA
TCAGGAGGTTCCTGTTGTCTTTGAAACAGTGCTCGATCCTGATGGACGAATTATGGTTCTGGATAGCTAA