SecReT6
Protein ID: 551595764
SecReT6 ID861
T6SS typei1
Gene symbol-
Locus tagDESAM_21884
StrainDesulfovibrio hydrothermalis str. sp nov AM13
Repliconchromosome [GenBank: NC_022579] [Browse all T6SS(s) in this replicon]
Location [Strand]2273259..2274302 [+]
ProductType VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.00E-73, Aligned region: 18..320
Protein Sequence: 347 a.a.     [Download]
>gi|551595764|ref|YP_008685057.1| Type VI secretion protein, VC_A0111 family [Desulfovibrio hydrothermalis]
MECDDRRSSASVTGRLLDNPEEYSFFQAIRLLRLHSGACTGKDLETFFRDYLRVRPQLSLGFPATDLTDL
EEEALEDGDRYRLETTFMGLYGASSPLPVFYTEELLTEASDDKSVTRDFIDIINNGVYVQFFKAWSRSRL
MIKAVDERDSSWLERLNCLLGLGHKENLAVIPEECRRYRHIGLLTQYPRSALGLNTLLKDSLQHNNVRVE
QCVLRKVKLPEDQRFSLGVSSNVLGEESLVGEELEDRTSKCAIVIRDLDAARYHQLLPGDGDGEVLDNLV
RGYLVEPFKYDLILEMRPGEAKTAVLGGDQWSGLGCDTWIFSGGHLEHAAATFPNEGGHVHSADSTL
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|551593593|ref|NC_022579.1|:2273259-2274302 Desulfovibrio hydrothermalis str. sp nov AM13 chromosome, complete genome
GTGGAATGCGATGATCGGCGATCGTCCGCTTCTGTAACAGGAAGGCTGCTTGATAATCCTGAGGAGTATT
CTTTTTTTCAGGCTATCCGTTTGCTGCGCCTGCATTCCGGGGCGTGTACCGGCAAAGATCTGGAAACTTT
TTTCCGCGATTATCTTCGGGTGCGTCCGCAGCTTTCACTGGGATTTCCGGCGACAGACTTAACCGATCTG
GAAGAGGAGGCTCTTGAGGATGGTGACCGTTACCGTCTGGAAACAACCTTTATGGGATTGTATGGTGCTT
CGTCTCCGCTGCCGGTTTTTTATACTGAAGAACTGCTTACTGAAGCATCGGATGACAAATCGGTCACCAG
AGATTTTATCGATATCATAAATAATGGTGTCTATGTCCAGTTTTTCAAAGCATGGAGCAGATCACGGCTG
ATGATCAAGGCCGTTGATGAACGCGACAGCTCATGGCTGGAACGTTTGAACTGCCTGCTTGGTTTGGGGC
ACAAAGAAAACCTTGCTGTCATACCGGAAGAATGCCGCCGTTATCGCCATATAGGACTTTTGACTCAATA
TCCAAGGAGTGCGCTGGGGCTTAATACTTTGCTCAAGGATTCGCTTCAGCACAATAATGTGCGGGTGGAG
CAATGTGTTTTGCGCAAAGTGAAACTTCCGGAGGATCAACGTTTTTCACTTGGTGTGAGTTCCAATGTGC
TGGGAGAGGAGTCTCTGGTCGGGGAAGAGCTTGAAGACCGCACTAGTAAATGTGCCATTGTCATTCGCGA
TCTGGATGCTGCGAGGTATCACCAGTTATTACCCGGAGATGGTGACGGTGAAGTTCTGGATAATCTTGTG
CGCGGTTACCTGGTGGAACCTTTTAAATATGATCTCATCCTTGAAATGCGGCCCGGCGAAGCTAAGACGG
CTGTTCTCGGTGGCGATCAGTGGTCCGGTCTGGGATGCGATACGTGGATTTTTTCCGGCGGTCATCTCGA
ACATGCTGCGGCTACTTTCCCCAATGAAGGGGGACATGTTCATTCTGCCGATTCAACGCTGTAA