SecReT6
Protein ID: 551595766
SecReT6 ID861
T6SS typei1
Gene symbol-
Locus tagDESAM_21886
StrainDesulfovibrio hydrothermalis str. sp nov AM13
Repliconchromosome [GenBank: NC_022579] [Browse all T6SS(s) in this replicon]
Location [Strand]2276988..2279264 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-60, Aligned region: 29..330
Phage_base_V [PF04717], Evalue: 2.40E-14, Aligned region: 395..468
CCDC155 [PF14662], Evalue: 0.00048, Aligned region: 610..686
Protein Sequence: 758 a.a.     [Download]
>gi|551595766|ref|YP_008685059.1| Rhs element Vgr protein [Desulfovibrio hydrothermalis]
MADNSKPKFTFESNAVDKNTFSVVNFKGTEGLSTIYRFSIMLISEKGDLDLNSILQNPAELTIKRDDGDI
PFKGMLSSFEQLHQAAGVVFYRAELVPKLWWTTLTHCNQIFLNENAQSFLGEVLKKGGLKEGLNFDFKLQ
GSYPSWEYVCQYDESHFNFVSRWMERYGMYYFFEQTDQGEKMVITDTHISHSPMTEGTSLSYSPPSNLDH
TKREEIIKNFMLKQQPLPKKVMLKDYNYQKPSLEMKSEAMVSEHGMGEIYIYGEHFKTPGEGDKLAQIRA
QEFLCREKVFHGVSTVPYVRTGYIFELKDHYRQDFNQRYLTTEVVHEGSQEAYLVSGLGLHLADNEDRLY
YRNTFTCIPAQVQFRPERKAVKPKFSGSMNAKIDAAGSGQYAELDGQGRYKVILPFDESGRHEGKATTWL
RMAQPYGGSDHGMHFPLHKGTEVLLTCIDGDPDRPIIQAAAPNPETPSLVKDTNQTKCLITTGGLNLFHI
QDEKGSEGMRLHTPHSNTSIRLGAVSNDSDSGTTTGSDGAEEEESDGIKFATEKDIKISGANIGTWVKGN
EFKIITGGSQEIVVGNDTKVFIGGKEDFVVGGELGVKIGPSKEFATHKSELEIEVRKLKGQANSLEGEHN
RLVGEVSELAEAKEQLIMAHTTLREDHNTLSAEHNSLKGTTAQLAGESSKLAGQVDTVWGEMNTVAGCLT
NLCGEVTELAGEDNKIVGVMAKSIGETTKLVGTSSTVTAETSKISGEMNNIAGLINNI
 
Nucleotide Sequence: 2277 bp     [Download]
>gi|551593593|ref|NC_022579.1|:2276988-2279264 Desulfovibrio hydrothermalis str. sp nov AM13 chromosome, complete genome
ATGGCAGATAACTCTAAGCCGAAATTTACGTTTGAATCCAACGCAGTAGACAAAAACACGTTCAGTGTAG
TCAATTTTAAAGGGACTGAAGGACTTTCGACCATTTACCGGTTCAGCATTATGCTGATTTCCGAGAAAGG
GGATCTGGATTTGAATTCCATCCTTCAGAATCCGGCAGAACTTACAATCAAACGTGACGATGGTGATATT
CCGTTTAAAGGTATGCTCAGTTCTTTTGAGCAGTTGCATCAGGCCGCAGGGGTGGTTTTTTACCGCGCTG
AACTGGTCCCCAAATTATGGTGGACTACGCTTACCCATTGCAATCAAATCTTTCTAAATGAAAATGCCCA
AAGTTTTCTGGGAGAAGTCCTCAAGAAAGGCGGATTAAAAGAGGGCCTTAATTTCGATTTTAAGCTTCAG
GGGTCTTATCCCTCATGGGAATATGTCTGCCAGTATGATGAATCGCATTTTAATTTTGTTTCCCGCTGGA
TGGAACGGTATGGGATGTATTACTTTTTTGAGCAGACTGATCAGGGCGAAAAAATGGTGATTACTGATAC
TCATATCTCACATTCGCCTATGACCGAAGGTACTTCTCTAAGCTATTCTCCGCCCAGTAATCTGGACCAT
ACCAAGCGTGAGGAAATAATTAAAAACTTTATGCTCAAGCAGCAGCCTTTGCCCAAAAAGGTTATGCTGA
AAGATTATAATTATCAAAAACCGAGCCTTGAAATGAAGTCCGAGGCAATGGTTTCTGAGCATGGAATGGG
CGAAATCTATATCTACGGAGAGCATTTTAAGACTCCCGGAGAGGGGGATAAGCTGGCTCAGATCAGGGCG
CAGGAATTTCTTTGCCGTGAAAAAGTTTTTCATGGAGTGTCTACTGTTCCATACGTCCGTACCGGATATA
TTTTTGAACTCAAAGATCACTATCGGCAGGATTTCAATCAGCGCTATTTAACAACTGAAGTTGTGCATGA
AGGAAGTCAGGAGGCTTATCTCGTTTCCGGTCTGGGGCTTCATTTAGCTGATAATGAAGACCGCTTATAC
TATCGAAACACATTTACGTGCATCCCTGCTCAGGTTCAGTTCAGGCCGGAGCGTAAGGCCGTGAAGCCTA
AGTTTTCCGGTTCGATGAATGCAAAGATTGATGCTGCCGGCAGCGGTCAATATGCCGAGCTGGACGGTCA
GGGACGTTACAAAGTTATTTTGCCTTTTGATGAATCAGGCAGGCATGAGGGCAAGGCTACTACATGGCTG
CGTATGGCCCAGCCGTATGGTGGTTCAGATCACGGCATGCATTTCCCTTTGCATAAAGGAACCGAAGTCT
TACTGACCTGCATTGACGGAGATCCCGACAGACCGATTATTCAGGCCGCGGCCCCCAACCCTGAAACCCC
CAGTCTGGTGAAGGATACCAACCAGACTAAGTGCTTGATAACTACCGGCGGGTTGAACCTTTTTCATATA
CAGGATGAGAAAGGCAGTGAAGGGATGCGGCTGCATACGCCCCATTCCAACACTTCTATACGCCTTGGGG
CTGTATCAAATGACAGCGATTCGGGAACAACCACCGGTTCCGACGGGGCAGAGGAAGAAGAGTCCGATGG
TATCAAGTTTGCCACGGAGAAAGATATTAAGATCAGCGGCGCGAATATTGGAACATGGGTAAAGGGCAAT
GAGTTTAAAATTATCACAGGCGGGTCACAGGAAATTGTAGTCGGAAATGACACCAAGGTTTTTATTGGCG
GTAAGGAAGATTTTGTTGTGGGAGGTGAACTGGGAGTTAAAATAGGGCCTTCCAAAGAATTTGCAACTCA
TAAAAGTGAGTTGGAAATAGAAGTCAGAAAGCTTAAAGGACAGGCTAATTCTCTCGAAGGGGAGCATAAC
AGGCTTGTCGGTGAAGTTTCGGAGCTGGCAGAAGCTAAAGAGCAGTTGATCATGGCTCATACTACTTTGC
GCGAAGATCATAATACATTGTCTGCTGAACATAATTCTTTGAAAGGCACAACTGCTCAGCTTGCAGGAGA
ATCGAGTAAGCTTGCCGGACAGGTTGATACGGTCTGGGGTGAAATGAACACGGTAGCAGGGTGTTTAACA
AATCTTTGTGGTGAAGTGACTGAGCTTGCCGGAGAGGATAATAAGATTGTTGGAGTTATGGCCAAAAGCA
TCGGAGAAACTACCAAGCTTGTTGGAACCTCTTCAACCGTTACCGCAGAAACCAGCAAAATCTCAGGTGA
AATGAATAATATTGCAGGTTTGATCAACAACATCTAA