SecReT6
Protein ID: 551595773
SecReT6 ID861
T6SS typei1
Gene symbol-
Locus tagDESAM_21893
StrainDesulfovibrio hydrothermalis str. sp nov AM13
Repliconchromosome [GenBank: NC_022579] [Browse all T6SS(s) in this replicon]
Location [Strand]2287951..2288529 [+]
ProductType VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.70E-25, Aligned region: 15..186
Protein Sequence: 192 a.a.     [Download]
>gi|551595773|ref|YP_008685066.1| Type VI secretion lipoprotein, VC_A0113 family [Desulfovibrio hydrothermalis]
MRCKCFKLFFVMLLFITVSCGGKQKPVDPTTVTTPASSPDQMKWTYQTNAISFQLNVDKNLNEYDGSPHS
LLLCVYQLTELSKFKELAGSTTGLGKLYNCTSFGPTVKQVKREFVQPGKNATISMDRAEGAKFVGIAAGY
YDLQGGGATRTWQIPMNISETGMLFWSDTWYAPAKLDAMIILGPHEIQKVGE
 
Nucleotide Sequence: 579 bp     [Download]
>gi|551593593|ref|NC_022579.1|:2287951-2288529 Desulfovibrio hydrothermalis str. sp nov AM13 chromosome, complete genome
ATGCGCTGTAAGTGCTTTAAACTGTTCTTTGTTATGCTTTTATTTATTACCGTAAGTTGCGGGGGTAAAC
AGAAGCCTGTTGACCCTACTACAGTAACGACTCCGGCATCCAGTCCAGATCAGATGAAATGGACCTATCA
GACTAATGCCATTTCCTTTCAATTGAATGTTGACAAAAATTTAAATGAATACGACGGATCGCCGCATTCG
CTTTTGCTGTGCGTTTACCAGTTAACGGAGTTGAGTAAGTTTAAGGAGCTGGCAGGCTCAACCACCGGGC
TGGGCAAATTATATAACTGCACAAGCTTTGGGCCTACGGTTAAACAGGTTAAACGGGAATTTGTTCAACC
CGGAAAAAATGCAACAATATCAATGGACCGGGCCGAAGGGGCGAAGTTTGTAGGTATTGCAGCCGGGTAT
TATGATCTTCAGGGTGGCGGGGCTACCCGTACATGGCAGATTCCCATGAATATATCGGAGACAGGAATGC
TTTTCTGGTCGGATACATGGTATGCTCCGGCTAAACTGGATGCCATGATAATTCTTGGTCCGCATGAGAT
ACAAAAGGTCGGGGAGTAA