SecReT6
Protein ID: 551595774
SecReT6 ID861
T6SS typei1
Gene symbol-
Locus tagDESAM_21894
StrainDesulfovibrio hydrothermalis str. sp nov AM13
Repliconchromosome [GenBank: NC_022579] [Browse all T6SS(s) in this replicon]
Location [Strand]2288533..2289912 [+]
ProductType VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.50E-83, Aligned region: 19..451
Protein Sequence: 459 a.a.     [Download]
>gi|551595774|ref|YP_008685067.1| Type VI secretion protein, VC_A0114 family [Desulfovibrio hydrothermalis]
MHANKPLFWHQGLFLQPQHFQLADLHQLHRLRAIREFGQPYFWGVTRLKIRTGALERRNFEVSDIEILFD
DGNFVCFPGNAKLEPRSFDKAWVDGEKPFMVYLGLRKWNPEGGNVSLVDDDASVVNTMFAASPDPEELPD
MLGNGPVAQVKPMRYVLRLFFENELEDLGAYTILPLARLILDVQQVRLDDSFIPPALTMRASDSLNNIFK
DISDQVASRCRRLEQYKNPAGLGAGDLDFTSTVFLLALRTLNRYAPKLKHLADAPNIHPWKAFGVLRQII
GELSSFSRDISALGEGGSGEKLVPDYDHENLGPCFEAARSIITHILDSLTAGPEFMSQFVFEDPYYTAEL
PERAFGPGNTFWLLVRTDRPDQALPEILKIAKLSATRGMSALLARAVHGIGLIHVENPPPGLPRSKGALC
FRFDTLSHLWEDVEKSRSISLYWDSAPKEMTAYIAAMRG
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|551593593|ref|NC_022579.1|:2288533-2289912 Desulfovibrio hydrothermalis str. sp nov AM13 chromosome, complete genome
GTGCACGCTAATAAACCGCTTTTCTGGCATCAGGGATTATTTTTACAACCTCAGCATTTTCAACTGGCTG
ATCTGCACCAGTTGCATCGGCTGCGCGCAATTCGTGAATTTGGGCAGCCTTATTTCTGGGGGGTGACCCG
GTTGAAAATTCGCACGGGCGCACTTGAGCGTCGCAATTTTGAAGTCAGTGATATTGAAATTTTGTTCGAT
GACGGTAATTTTGTTTGTTTTCCCGGCAACGCAAAGCTTGAGCCTCGTTCGTTTGATAAGGCATGGGTGG
ATGGCGAGAAGCCCTTTATGGTTTATCTCGGTTTGCGGAAATGGAATCCTGAAGGCGGGAACGTTTCCCT
TGTGGATGACGATGCATCGGTTGTGAACACTATGTTTGCCGCGTCTCCCGATCCTGAAGAGTTACCCGAT
ATGCTTGGAAACGGACCTGTGGCTCAGGTCAAACCCATGCGTTATGTGCTGCGTCTTTTTTTCGAAAATG
AACTGGAAGATCTTGGAGCATATACCATACTTCCGCTGGCCCGTCTGATTCTTGATGTTCAGCAGGTCCG
TCTGGATGACAGTTTCATCCCGCCTGCTTTGACCATGAGAGCTTCGGATTCATTGAATAATATTTTTAAA
GATATAAGTGATCAGGTGGCTTCCCGTTGCCGCCGGCTGGAGCAGTATAAAAATCCGGCAGGACTCGGAG
CAGGTGATCTGGATTTCACTTCAACTGTTTTCCTGCTCGCTTTGCGAACTCTGAACCGGTATGCTCCGAA
ATTAAAGCATCTGGCTGATGCTCCTAACATCCATCCTTGGAAAGCGTTCGGTGTATTGCGCCAGATTATC
GGGGAGTTATCTTCATTTTCGCGTGATATATCTGCCCTTGGCGAAGGGGGGAGCGGTGAAAAGCTTGTAC
CTGATTATGATCATGAAAATCTGGGGCCTTGTTTCGAAGCAGCGCGGTCTATTATTACTCATATTCTTGA
CAGCCTTACTGCCGGACCTGAATTTATGAGTCAGTTCGTTTTTGAAGATCCGTATTACACCGCGGAGCTG
CCGGAACGTGCTTTCGGTCCGGGAAATACTTTCTGGCTGCTGGTCAGAACCGACCGCCCTGATCAGGCCC
TTCCGGAAATCTTAAAGATTGCCAAACTTTCAGCGACCAGAGGCATGAGTGCTTTGCTCGCCAGAGCGGT
GCATGGCATTGGATTAATTCATGTTGAGAATCCGCCTCCCGGACTTCCCCGTTCCAAGGGTGCTCTTTGT
TTCCGCTTCGATACTCTGTCTCACCTGTGGGAAGATGTTGAGAAGTCGCGCAGTATTTCACTGTACTGGG
ATTCCGCTCCTAAAGAAATGACGGCTTATATCGCGGCTATGAGAGGTTAA