SecReT6
Protein ID: 551595775
SecReT6 ID861
T6SS typei1
Gene symbol-
Locus tagDESAM_21895
StrainDesulfovibrio hydrothermalis str. sp nov AM13
Repliconchromosome [GenBank: NC_022579] [Browse all T6SS(s) in this replicon]
Location [Strand]2289919..2290662 [+]
ProductType IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.70E-41, Aligned region: 2..112
DUF2077 [PF09850], Evalue: 5.70E-41, Aligned region: 139..235
Protein Sequence: 247 a.a.     [Download]
>gi|551595775|ref|YP_008685068.1| Type IV / VI secretion system protein, DotU family [Desulfovibrio hydrothermalis]
MHLSDCFLELFTFIRFLADSPEMADAEYDAVHEDVSKLIERLEQRADKCGFAPDLFDKARFAVFAWVDEA
VLCSSWSGTRQWLRHPLQREYYGTTNAGEEFFERLDMLLDGNHVPVDESLFADLEKDSNENAPAGKIENA
NSEVLEVYTLCLSLGYTGKYFSESDTERLDKLRNDCIARIMGKQGGNGLAAFPAAYGTGEKALRTSQYGR
VFDPLSIVFIVLPVLVVAGVFFAYRGLLEYSLNLWLG
 
Nucleotide Sequence: 744 bp     [Download]
>gi|551593593|ref|NC_022579.1|:2289919-2290662 Desulfovibrio hydrothermalis str. sp nov AM13 chromosome, complete genome
ATGCATCTGTCAGACTGCTTTCTGGAACTCTTCACCTTTATCCGCTTTTTGGCTGATTCTCCGGAAATGG
CCGATGCAGAGTATGATGCTGTGCATGAAGATGTCTCAAAGCTTATTGAACGTCTGGAACAGAGAGCTGA
TAAATGCGGCTTTGCTCCTGATCTGTTTGATAAAGCAAGGTTTGCAGTATTTGCATGGGTGGATGAAGCT
GTACTTTGTTCTTCATGGTCAGGAACCCGTCAGTGGCTCCGGCATCCTTTGCAGAGGGAGTATTACGGCA
CGACCAATGCGGGGGAGGAGTTCTTTGAGCGTCTCGATATGCTGCTTGACGGGAATCATGTTCCTGTTGA
TGAGAGTCTTTTTGCCGATCTTGAAAAGGATTCAAATGAAAATGCACCTGCCGGTAAAATAGAAAACGCT
AATTCTGAAGTGCTAGAAGTTTATACCTTATGTCTGTCCCTTGGTTATACTGGAAAATATTTCAGCGAGT
CGGATACTGAACGTCTTGATAAGCTGCGCAATGATTGCATTGCGCGGATAATGGGGAAGCAGGGCGGCAA
CGGGCTGGCTGCTTTTCCGGCAGCGTATGGAACTGGAGAGAAAGCTCTCCGCACTTCACAATATGGTCGG
GTTTTTGATCCGCTTTCCATTGTTTTTATTGTTCTTCCGGTGCTTGTGGTGGCTGGTGTTTTTTTCGCCT
ATAGGGGCCTTCTCGAATACAGTCTCAACCTATGGTTGGGCTGA