SecReT6
Protein ID: 556554732
SecReT6 ID862
T6SS typei2
Gene symbol-
Locus tagP423_15400
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3133789..3135327 [+]
ProductEvpB/family type VI secretion protein
NoteTssC
UniProt IDU5SR52
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-173, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|556554732|ref|YP_008723072.1| EvpB/family type VI secretion protein [Escherichia coli JJ1886]
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDSWQNSETLADASPDERVTAAIHVLLSC
LAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDV
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDINLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3133789-3135327 Escherichia coli JJ1886, complete genome
ATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTCACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTTGATAAAATTAATTTAACCCCGGTCTCTTCCATTCAGGAAATCGATTCATGGCAAAA
CAGCGAAACGCTGGCCGATGCCTCACCCGATGAGCGCGTGACGGCGGCTATCCACGTTCTGCTTTCCTGT
CTGGCGAAGTCTGGCGAGGACGTGGTTAAACTCGACAAAAGCCTGCTGGATTTTCATATCGACGATCTGG
ATCAGAAAATCAGTAAACAGCTTGATGCAGTCATGCACCATCCGGAATTCCAGAAAGTCGAGTCGCTCTG
GCGCGGCACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAACTGCTGGATGTC
AGTAAAGAACATCTGCGGCAGGACTTTGATGATTCTCCGGAAATCATTCAAAGTGGTTTATATCGCCATA
CATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTAGCCTCATTAATATCCAGCTATGAATTCGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGTAATATTTCCAGAGTCTCTGCTGCATCACATATGCCCTTT
ATCGGTTCCGTCGGACCGAAGTTCTTCCTTAAAAACTCGATGGAAGAAGTCGCCGCAATTAAAGATATCG
GCAACTATTTTGACCGCGCGGAATATATCAAATGGAAGTCGTTCCGCGATACCGACGACAGTCGCTACGT
GGGATTAGTGATGCCGCGCGTGCTGGGCCGTCTGCCCTATGGGCCGGACACAGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAATACCTCTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGTCCGCAGGCGGGTGG
CGCAGTGGCCGATCTGCCGATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAACCTTGGCTTTATTCCGCTCTCTTATTATAAGA
ATCGCGATTACGCCTGCTTCTTCTCAGCGAACTCTGCCCAGAAACCGGCGTTGTATGATACCGCTGACGC
CACCGCCAACAGTCGTATTAACGCCCGTTTGCCCTATATTTTCCTGCTGTCCCGCATTGCGCATTACCTG
AAAATCATCCAGCGCGAGAATATCGGTACCACCAAAGACCGCCGCGTACTGGAACTGGAGCTTAACACCT
GGATCCGCACACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCTGCGCGA
CGGCAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATTGAAGGGATGGATATCAACCTGTCACTGGTTTCCCAGATGCCGAAAGCGAAAGCCTGA