SecReT6
Protein ID: 556554733
SecReT6 ID862
T6SS typei2
Gene symbol-
Locus tagP423_15405
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3135345..3136682 [+]
Producthypothetical protein
NoteTssK
UniProt IDU5SUB1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-131, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|556554733|ref|YP_008723073.1| hypothetical protein P423_15405 [Escherichia coli JJ1886]
MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDSIAQLCIRHPWGIANVLFDRDALTSGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLRALKNDSAIVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQDESYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSIVFPPLFSLLSELLEASLPSRVIALDLASLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVPLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGCCMIYAPGTMGDLKPELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3135345-3136682 Escherichia coli JJ1886, complete genome
ATGAAAATTCATCGACCACTGTGGGCTGAGGGGACATTCCTGTCCTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACAGCATTGCGCAACTTTGTATTCGTCATCCGTGGGGGATCGCGAATGT
GCTCTTTGACCGCGATGCCCTGACGTCCGGAAAGCTGAAAACGCAGGCTGTACGTCTGCGTTTTGCTGAT
GGCACGCTGATCGATTCAGACGTGAGTGACGTTCTGCCGCTCGCCTGCGATCTGCGCGCGCTGAAGAACG
ACAGCGCGATTGTCCTGCTGGCGCTGCCGCTTGCGCATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTGCGCTATCGTCAGGAATGGCAAAAGGTGCAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGATTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGAGCTATATTCCGCCGTT
ACTGGCGTTTAACGCCCATGACGGGCTGGTACAGCGTCTGGACACGCTGCTGTTGCAGCTACGGGCGAAG
TGCCAGCGTCTGATGGCGATGCGCCGGGAAAGCAACCAGCGTATGGCGGACTTCGCTGTCGCCGATGTCT
CCCTGTTCTGGCTGCTTAACGCGCTGAACTCCGCCGAGCCGGTACTGAGTGATTTCCTGCGCTACCCGGC
GGTTCATCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGTGCGCTGCTGACGTTTTCCCTTGAA
CATAACGTCAGCGCCGTTCCGCCCTATGTCCACGAATCGCCGTCCATCGTCTTTCCGCCACTTTTCTCCC
TGCTCAGCGAACTGCTGGAAGCCAGCCTGCCGTCACGGGTGATCGCGCTGGATCTGGCGTCCCTGCCGGG
CAACCGCTGGAAAGCAGACCTGCACGATCCGCGCCTGCGGGAAGAGGCCGACTTTTACCTGTCCGTTCGT
TCCTCTCTGCCTGCGCATCAGGTACTGCACCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCTGATGACG
TCACGCTGCTTATCAATGTGGCGCTGAATGGTGTTCCACTGGTGCCGCTTACCTCAGTTCCGGCAGCGCT
GCCACTGCGGCTGGAGAACCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGTGCTGCATGATTTATGCGCCGGGAACAATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCACATGA