SecReT6
Protein ID: 556554734
SecReT6 ID862
T6SS typei2
Gene symbol-
Locus tagP423_15410
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3136679..3137344 [+]
Producttype VI secretion protein ImpK
NoteTssL
UniProt IDU5STU9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-49, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|556554734|ref|YP_008723074.1| type VI secretion protein ImpK [Escherichia coli JJ1886]
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVELVRERLKDAGFSRESVEHITYAQCAL
LDETVLSRGGMDDGQAIWMKDPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSPRQHPLLHSPFFWLVTLTLVLAGVWWGLHYWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3136679-3137344 Escherichia coli JJ1886, complete genome
ATGAAAAAAGAGACGGATATCAATATCGACGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATGGAGCTGTATCGCCACTGCCAGCGGCAGGTGGAACTGGTCCG
CGAACGCCTGAAAGATGCCGGGTTCAGCCGGGAGAGCGTGGAGCACATTACTTACGCGCAGTGCGCCCTG
CTGGACGAAACGGTCCTGAGCCGTGGCGGCATGGACGACGGTCAGGCCATCTGGATGAAGGATCCACTCC
AGTCGCATTTCTTCAACACTCTGCAGGCCGGTGAGCTGCTGTACGAGCGGATGAAGCAGGTGCTACAGGA
GCCCGCCCCCGCGCAGGCCGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGCAGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCAGGTCGCGCCATTTGGTG
TGCTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCCCCCGTCAGCACCCTTTGCTGCATTCGCCGTT
TTTCTGGCTGGTGACGCTCACACTGGTACTGGCCGGTGTCTGGTGGGGGCTACATTACTGGCTGAACGTG
CTGGTGGATGAACTGCTGCCGCAAAGTCTGCGTTAA