SecReT6
Protein ID: 556554737
SecReT6 ID862
T6SS typei2
Gene symbol-
Locus tagP423_15430
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3142397..3144721 [+]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDU5SR56
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.60E-64, Aligned region: 30..347
DUF2345 [PF10106], Evalue: 3.10E-45, Aligned region: 606..751
T6SS_Vgr [PF13296], Evalue: 2.00E-33, Aligned region: 480..585
Phage_base_V [PF04717], Evalue: 3.10E-14, Aligned region: 392..473
Protein Sequence: 774 a.a.     [Download]
>gi|556554737|ref|YP_008723078.1| type IV secretion protein Rhs [Escherichia coli JJ1886]
MNVQFFDHAHHKLKIRGLKSPVDVLTFTGHEQLSSPFRYDIEFTSTDKAIEPESVLMQDGAFSLSAPPVQ
GMPVQVPLRTLHGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRERHQMR
GQDFVFNLKSEYPSREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVVEFYDDQSGYERGLTLPL
RHPSGLFDGETEAVWGLNTAYSVVEKSVTTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQK
GDKEAAESGAFYARIRHERYLNEQAILKGQSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDLWGAVRAKKGIFISADAQDKAQGQ
VREMADIISELNSLSDKIQKLSDDAATANADPADMAAQVALITSRINDLTASVILMHAPKGVAVASGEHL
QLAAVKNLQINAGNNADIGVVKNMFIGVGRALSVFVRKAGIKLIANKGAVSVQAQHDLMELLAKKSIEIV
STEDEIRISAKKKITINGGGSYIRIEGSGIEPGTPGDYNVKAVHYGRMGKAHEPVELQMLAEKVDEPPVK
FFFS
 
Nucleotide Sequence: 2325 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3142397-3144721 Escherichia coli JJ1886, complete genome
ATGAACGTACAGTTCTTCGACCACGCACACCACAAGCTCAAAATTCGCGGCCTGAAAAGCCCGGTGGACG
TGCTGACTTTTACAGGCCACGAACAGCTCAGCTCACCCTTCCGCTACGACATTGAGTTTACCAGTACCGA
TAAAGCCATCGAGCCGGAGTCGGTACTGATGCAGGACGGCGCATTCAGCCTGAGCGCCCCGCCGGTACAG
GGGATGCCGGTGCAGGTCCCCCTGCGCACCCTGCACGGCGTCATTACCGGCTTTAAACACCTCTCCTCGT
CACAGGACGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGTATGGCGCTGCTTACCCGCAGCCGCCAGAA
CGCCATCTACCAGAACCAGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGTCCCGCGAACAGGTGATGCAGTACGGTGAGG
ACGACCTGACGTTTGTCTCACGCCTGCTGTCGGAAGTGGGTATCTGGTTCCGCTTTGCCACCGACGCCCG
GCTGAAAATCGAAGTTGTCGAGTTTTATGACGACCAGAGCGGCTACGAGCGCGGGCTGACACTGCCGCTT
CGCCATCCTTCAGGGCTGTTTGATGGTGAAACGGAAGCGGTATGGGGGCTGAATACCGCGTACAGCGTGG
TGGAAAAAAGCGTCACCACTCGGGACTACAACTACCGCACCGCCACAGCAGAGATGATGACAGAGCAGCA
TGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTATGCCGACAACTTCCTGCAAAAA
GGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGCCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCAGGGCGA
CGACGCGCCAGCAGTGTTCCGCAAGGGCGTACTGATTACCGGCGTGACGGCCAGCGCGGCGCGTGACCGC
AGCTATGAGCTGACGTTTACCGCCATCCCGTACTCAGAGCGCTACGGCTACCGCCCGGCGCTTATCCCCC
GCCCGGTAATGGCCGGCACACTCCCGGCGCGGGTCACCAGCACGGTGAAAAACGATATCTATGCCCATAT
CGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCGGGTTATGAAAGC
CTGTGGGTGCGCCAGTCGCGCCCGTATGCAGGTGACACGTATGGCCTGCATCTGCCGCTGCTGGCGGGAA
CGGAAGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACCGACCTTATATCGCCGGGGTAAAACACGACTC
GGCACACACCGACCATGTGACCATTCAGAACTACAAGCGCAACGTGCTGCGCACCCCGGCGAACAACAAA
ATCCGCCTCGACGATGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTACGGCGGCAAGAGCCAGC
TCAACCTCGGCCATCTGGTGGATGCCGGAAAACAGCAGCGCGGGGAAGGTTTTGAACTGCGTACCGATCT
GTGGGGTGCAGTACGGGCAAAGAAAGGCATCTTTATCAGCGCCGACGCGCAGGATAAGGCGCAGGGTCAG
GTACGCGAAATGGCCGACATTATCAGCGAACTGAACAGCCTGAGCGATAAAATCCAGAAACTGTCTGACG
ATGCGGCCACGGCGAACGCCGATCCGGCGGATATGGCCGCGCAGGTGGCGCTGATAACCAGCCGGATAAA
TGACCTGACCGCCTCGGTGATTTTGATGCACGCGCCGAAAGGTGTGGCGGTCGCCAGCGGCGAGCACCTG
CAACTGGCCGCAGTGAAAAACCTCCAGATAAATGCGGGAAACAACGCCGATATCGGCGTGGTGAAGAATA
TGTTTATCGGCGTAGGGCGGGCGCTGAGCGTGTTTGTGCGCAAGGCGGGTATCAAACTGATTGCCAATAA
AGGCGCAGTATCGGTACAGGCGCAGCACGATCTGATGGAGTTACTGGCGAAGAAGTCGATAGAGATCGTC
AGTACTGAGGACGAGATCAGGATTTCAGCGAAGAAAAAAATAACGATTAATGGTGGTGGAAGTTATATCC
GGATTGAGGGTAGCGGCATTGAGCCGGGAACGCCGGGGGATTATAACGTCAAAGCGGTGCATTACGGGCG
TATGGGAAAAGCACATGAGCCTGTTGAGTTACAAATGTTGGCAGAGAAAGTAGATGAGCCACCCGTAAAA
TTTTTCTTTTCTTAA