SecReT6
Protein ID: 556554740
SecReT6 ID862
T6SS typei2
Gene symbol-
Locus tagP423_15445
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3148414..3150792 [+]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDU5SQI5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-63, Aligned region: 32..349
DUF2345 [PF10106], Evalue: 7.80E-45, Aligned region: 608..745
T6SS_Vgr [PF13296], Evalue: 1.70E-33, Aligned region: 482..587
Phage_base_V [PF04717], Evalue: 3.30E-14, Aligned region: 394..475
Protein Sequence: 792 a.a.     [Download]
>gi|556554740|ref|YP_008723081.1| type IV secretion protein Rhs [Escherichia coli JJ1886]
MDVPVLNFDHSHHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAIAPESVLMQDGAFSLTAPP
VQGMPVQTALRTLHGVITSFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNLTVPQIVEKILRERHQ
MRGQDFVFNLKSAYPSREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVVEFYDDQSGYERGLTL
PLRHPSGLFDGETEAVWGLNTAYSVVEKSVTTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFL
QKGDKEAAESGAFYARIRHERYLNEQAILKGQSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAAR
DRSYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGY
ESLWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPAN
NKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDLWGAVRAKKGIFISADAQDKAQ
GQVREMADIISELNSLSDKIQKLSDDAATANADPADMAAQVALITSRINDLTASVILMHAPKGVAVASGE
HLQLAAVKNLQINAGNNADIGVVKNMFIGVGRALSVFVRKAGIRLIANKGAVSVQAQHDLMELLAKKSIE
IVSTEDEIKITAKKKITINGGGSYIRIEGSGIEPGTPGDYNVKAVHYGRQPKASEKVPMPEFPILSAVDS
SDFCLECLLNAIKNDDAVVEGV
 
Nucleotide Sequence: 2379 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3148414-3150792 Escherichia coli JJ1886, complete genome
ATGGATGTTCCTGTTCTGAATTTCGACCACTCACACCACAAGCTCAAAATTCGCGGCCTGCAAAGTCCGG
TGGATGTGCTGACCTTCGAAGGCCGCGAACAACTGAGTACCCCGTTCCGCTACGACATTCAGTTTACCAG
TACCGATAAAGCCATCGCGCCGGAGTCGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCACCG
GTACAGGGAATGCCGGTGCAGACTGCCCTGCGCACCCTGCACGGCGTCATTACCAGCTTTAAACACCTCT
CCTCGTCACAGGACGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGTATGGCGCTGCTTACCCGCAGCCG
CCAGAACGCCATCTACCAGAATCTGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCACCAG
ATGCGCGGTCAGGACTTCGTGTTTAACCTCAAAAGCGCATACCCGTCCCGCGAACAGGTGATGCAGTACG
GTGAGGACGACCTGACGTTTGTCTCACGCCTGCTGTCGGAAGTGGGTATCTGGTTCCGCTTTGCCACCGA
CGCCCGGCTGAAAATCGAAGTTGTCGAGTTTTATGACGACCAGAGCGGCTACGAGCGCGGGCTGACACTG
CCGCTTCGCCATCCTTCAGGGCTGTTTGATGGTGAAACGGAAGCGGTATGGGGGCTGAATACCGCGTACA
GCGTGGTGGAAAAAAGCGTCACCACTCGGGACTACAACTACCGCACCGCCACAGCAGAGATGATGACAGA
GCAGCATGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTATGCCGACAACTTCCTG
CAAAAAGGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGCCACGAACGCTACCTGA
ATGAACAGGCCATTCTCAAAGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCA
GGGCGACGACGCGCCAGCAGTGTTCCGCAAGGGCGTACTGATTACCGGCGTGACGGCCAGCGCGGCGCGT
GACCGCAGCTATGAGCTGACGTTTACCGCCATCCCGTACTCAGAGCGCTACGGCTACCGCCCGGCGCTTA
TCCCCCGCCCGGTAATGGCCGGCACACTCCCGGCGCGGGTCACCAGCACGGTGAAAAACGATATCTATGC
CCATATCGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCGGGTTAT
GAAAGCCTGTGGGTGCGCCAGTCGCGCCCGTATGCAGGTGACACGTATGGCCTGCATCTGCCGCTGCTGG
CGGGAACGGAAGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACCGACCTTATATCGCCGGGGTAAAACA
CGACTCGGCACACACCGACCATGTGACCATTCAGAACTACAAGCGCAACGTGCTACGCACCCCGGCGAAC
AACAAAATCCGCCTCGACGATGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTACGGCGGCAAGA
GCCAGCTCAACCTCGGTCATCTGGTGGATGCCGGGAAACAGCAGCGCGGGGAAGGTTTTGAACTGCGTAC
CGATCTGTGGGGTGCAGTACGGGCAAAGAAAGGCATCTTTATCAGCGCCGACGCGCAGGACAAGGCGCAG
GGTCAGGTACGCGAAATGGCCGACATTATCAGCGAACTGAACAGCCTGAGCGATAAAATCCAGAAACTGT
CTGACGATGCGGCCACGGCGAACGCCGATCCGGCGGATATGGCCGCGCAGGTAGCATTGATAACCAGCCG
GATAAATGACCTGACCGCCTCGGTGATTTTGATGCACGCGCCGAAAGGCGTGGCGGTCGCCAGCGGCGAG
CACCTGCAACTGGCCGCAGTGAAAAACCTCCAGATAAATGCGGGAAACAACGCCGATATCGGCGTAGTGA
AGAATATGTTTATCGGCGTGGGACGGGCGCTGAGCGTGTTTGTACGCAAGGCGGGTATCAGGCTGATTGC
CAATAAAGGCGCAGTATCGGTACAGGCGCAGCACGATCTGATGGAGTTACTGGCGAAAAAATCGATAGAG
ATCGTCAGTACCGAAGATGAGATTAAAATCACCGCGAAGAAAAAAATAACGATTAATGGTGGTGGGAGTT
ATATCCGGATAGAGGGTAGCGGCATTGAGCCGGGAACGCCGGGGGATTATAACGTCAAAGCGGTACATTA
CGGGCGTCAGCCTAAAGCCTCGGAGAAGGTTCCTATGCCAGAATTTCCCATCCTTTCAGCCGTGGACTCA
TCCGATTTTTGTCTTGAATGCCTGCTGAATGCCATCAAAAACGATGACGCTGTTGTTGAAGGAGTGTAA