SecReT6
Protein ID: 556554744
SecReT6 ID862
T6SS typei2
Gene symbol-
Locus tagP423_15465
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3154158..3156671 [+]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDU5STV7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-63, Aligned region: 32..349
DUF2345 [PF10106], Evalue: 7.70E-46, Aligned region: 543..580
DUF2345 [PF10106], Evalue: 7.70E-46, Aligned region: 604..745
T6SS_Vgr [PF13296], Evalue: 2.10E-33, Aligned region: 482..586
T6SS_Vgr [PF13296], Evalue: 2.10E-33, Aligned region: 583..610
Phage_base_V [PF04717], Evalue: 3.90E-14, Aligned region: 394..475
Protein Sequence: 837 a.a.     [Download]
>gi|556554744|ref|YP_008723085.1| type IV secretion protein Rhs [Escherichia coli JJ1886]
MDIPTLNFDHSHHKLKIRGLKSPADVLTFTGHEQLSSPFRYDIEFTSTNKAITPESVLMQDGAFSLTAPP
VQGMPVQTALRTLHGVITSFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRERHQ
MRGQDFVFNLKNEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVVEFYDDQSGYERGLTL
PLRHPSGLFDGETEAVWGLNSAYSVVEKSVSTRDYNYREATAEMTTGQHDATGGDNTTYGEAYHYADNFL
QKGDKEAAESGAFYARIRHERYLNEQAILQGQSTSSLLMPGLEIKVQGDDAPAVFRKGVLITGVTASAAR
DRSYELTFTAIPYSERYGYRPALIPCPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGY
ESLWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPAN
NKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDLWGTVRAKKGIFISSDAQDKAQ
GKVREMAPAMAILDGAQSQMKSLSTDAQTANADPADLSSQIALLQQSVKDLTQAAILLSAPKGVAIASGE
HLQLAASKNLIANAGNHADIGVVKNMFIGVGQALSVFVRKAGIKLFANKGAISVQAQNDLMELLAQKSIE
ITSTEDEIKITAKKKITLNGGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIKSEDF
NQSFILLDENTGQPLINWPYELELESGLKMSGITDENGNTELISSDKEEVVNISVFEPDEFLDDEIN
 
Nucleotide Sequence: 2514 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3154158-3156671 Escherichia coli JJ1886, complete genome
ATGGATATCCCGACTCTGAATTTCGACCACTCACACCACAAGCTCAAAATTCGCGGCCTGAAAAGCCCGG
CGGATGTGCTGACGTTTACGGGCCACGAACAGCTCAGCTCACCCTTCCGCTACGACATTGAGTTTACCAG
TACCAATAAAGCAATAACGCCGGAGTCGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCC
GTGCAGGGAATGCCGGTGCAGACTGCCCTGCGCACCCTGCACGGCGTCATTACCAGCTTTAAACACCTCT
CATCGTCACAGGACGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGTATGGCGCTGCTTACCCGCAGCCG
CCAGAACGCCATCTACCAGAACCAGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGCCATCAA
ATGCGCGGTCAGGACTTCGTGTTTAACCTCAAAAACGAATACCCGGCCCGTGAACAGGTGATGCAGTACG
GTGAGGACGACCTGACGTTTGTCTCACGCCTGCTGTCGGAGGTGGGTATCTGGTTCCGCTTTGCCACCGA
CGCCCGGCTGAAAATCGAAGTTGTCGAGTTTTATGACGACCAGAGCGGCTATGAGCGCGGACTGACGCTG
CCGCTTCGTCATCCTTCAGGGCTGTTTGATGGTGAAACGGAAGCCGTATGGGGGTTGAACAGCGCGTACA
GCGTGGTGGAAAAAAGCGTCTCCACGCGGGACTACAACTACCGTGAAGCCACGGCGGAAATGACCACAGG
CCAGCATGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTACGCTGACAACTTCCTG
CAAAAAGGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGCCACGAACGCTATTTGA
ATGAACAGGCCATTCTACAGGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAGATAAAAGTTCA
GGGTGACGACGCGCCAGCGGTGTTCCGCAAGGGCGTACTGATTACCGGCGTGACGGCCAGCGCGGCGCGT
GACCGCAGCTATGAACTGACGTTTACCGCCATCCCGTACTCAGAACGCTATGGCTACCGCCCGGCGCTTA
TCCCCTGCCCCGTGATGGCCGGCACGCTCCCGGCACGGGTCACCAGCACGGTGAAGAACGACATCTACGC
CCATATCGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCGGGTTAT
GAAAGCCTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCATCTGCCGCTGCTGG
CGGGAACGGAAGTCAGCATCGCGTTTGAGGAAGGCAACCCGGACCGACCTTATATTGCAGGCGTAAAACA
CGACTCGGCACACACCGACCATGTGACCATTCAGAACTACAAGCGCAACGTACTGCGCACCCCGGCGAAC
AACAAAATCCGCCTCGATGACGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTATGGCGGCAAGA
GCCAGCTCAACCTCGGCCATCTGGTGGATGCCGGAAAACAGCAGCGCGGGGAAGGCTTTGAACTGCGTAC
CGATCTGTGGGGTACAGTACGGGCAAAGAAAGGCATCTTTATCAGCTCCGACGCGCAGGACAAGGCGCAG
GGTAAGGTGCGCGAAATGGCTCCGGCGATGGCAATACTGGATGGCGCACAGTCACAGATGAAGTCGCTGT
CCACTGATGCGCAGACGGCGAATGCCGATCCGGCAGATCTGTCATCACAGATAGCGCTGTTGCAGCAGAG
TGTAAAAGATCTGACGCAGGCTGCGATCCTGCTAAGCGCACCCAAAGGCGTGGCGATCGCCAGCGGAGAG
CACCTGCAACTGGCGGCGTCGAAAAACCTGATCGCGAACGCAGGAAATCACGCTGATATCGGTGTCGTGA
AGAATATGTTTATCGGCGTGGGTCAGGCGCTGAGCGTGTTTGTACGCAAAGCGGGTATCAAACTGTTTGC
CAATAAAGGGGCGATCTCGGTACAGGCACAGAACGATCTGATGGAACTGTTGGCGCAGAAATCGATAGAG
ATCACCAGTACGGAAGATGAGATTAAAATCACCGCGAAGAAGAAAATCACCCTTAACGGCGGTGGCAGCT
ACATCCGGCTGGATGCCTGTGGGATAGAGGCCGGTACGCCGGGAGAATATAACGTTAAGGCGGGATATTA
CGGGCGTAAGCCGAAGGCGAAGCTGACGCCGGAGCTGATGGCATTTCCGGTGATTAAGTCTGAGGATTTT
AATCAGAGCTTTATTTTGCTGGATGAAAATACTGGGCAACCACTTATTAATTGGCCCTATGAACTAGAAC
TGGAAAGTGGGCTAAAAATGAGTGGGATTACTGATGAAAATGGAAATACAGAACTAATATCCTCTGATAA
GGAGGAGGTCGTTAATATTAGTGTGTTTGAACCCGATGAGTTTTTAGACGATGAAATTAATTAA