SecReT6
Protein ID: 556554752
SecReT6 ID862
T6SS typei2
Gene symbol-
Locus tagP423_15505
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3165107..3166717 [+]
Producthypothetical protein
NoteTssA
UniProt IDU5SR72
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-20, Aligned region: 67..126
Protein Sequence: 536 a.a.     [Download]
>gi|556554752|ref|YP_008723093.1| hypothetical protein P423_15505 [Escherichia coli JJ1886]
MSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDPGYHDDFLRIRDEMNKLSGADTGLI
CQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLAGLVERFGTQLLPSRPASRKMALEWLAGE
KMLDSLARYPEVAKEDFANIVAALNQLSVSFTAWPEDQHSPSLMPLINALESRLAQSGGMNAVVPQNSSG
VPAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLAP
PRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALAKAGAPWDRWTAVIRQDLALLL
ERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMADSQGV
EAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPELLFEVKARQ
LKLLRLRAHRYADKALLNRKMEILLGTLVAIDPVRAAVLCDTQHKD
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3165107-3166717 Escherichia coli JJ1886, complete genome
ATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCGACCGGGATGCACTGGATGTGGCGCGAA
CACAGGCGGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGCAGACACGCCGGTCGGGGAAGACCCCGG
CTACCACGACGATTTCCTGCGTATCCGCGACGAAATGAACAAACTGTCCGGTGCCGATACCGGCCTTATC
TGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCCAAAGACGTGCGCATCGCCACTTACTACATCTGGG
CGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAAGGACTGGCGCTGTTAGCCGGGCTGGTGGAACG
CTTCGGTACGCAACTGCTGCCCTCGCGACCGGCAAGCCGAAAAATGGCGCTGGAGTGGCTGGCGGGGGAA
AAGATGCTCGACAGCCTTGCCCGCTACCCGGAGGTGGCAAAAGAGGATTTTGCGAACATTGTTGCCGCTC
TTAATCAACTGTCGGTTTCCTTCACTGCATGGCCCGAAGACCAGCATTCCCCCTCCCTGATGCCGCTGAT
TAACGCGCTGGAATCACGTCTGGCGCAGTCGGGCGGGATGAACGCGGTGGTGCCGCAAAACAGCAGCGGC
GTTCCGGCACCGTCTTCCCCGGTGGATGCGCCGCAGGTACAGACCATCACCTCCGGGCGCGACCTACTCG
ACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCAGGGCTGGCTTTCAGCACACCGGCTGAT
GAAAACCCTGCGCTGGGACACGGTGCATGAACTGCCGCCGGACGTGGACGGCAAAACCCGGCTGGCCCCG
CCGCGCACCGAATCACGCAACCAGCTTAAGCGGCTGTATGCCCAGCAGAACTGGACGGAACTGCTGGAGC
AGGCCGACCTGATGTTCAGCACCGGTGTCAGCCATTTCTGGCTGGATATCCAGTGGTATCTGCATCAGGC
GCTGGCGAAGGCGGGCGCACCGTGGGACAGATGGACAGCGGTTATCCGTCAGGACCTGGCGCTGCTGCTG
GAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGCACGCCGTTTGCCGATGAGGTGACGCGCA
ACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATGGCTTGCGGGGAAAGCCGCTGTGCCGAC
AGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCACTGGAGATGGCTGACAGTCAGGGCGTG
GAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCACGGCACGACAGCGCCTGTTATTGCGAC
TGCTGATGGCACGGGTGGCGGAACAGTACGGTAAAAACGAGATGGCGCTCCTGCTGCTGGAAGAACTGGA
TACCGCCGCACAGGGAATAACGCTGACACAGTGGGAGCCAGAGCTGCTGTTTGAAGTAAAAGCCCGACAA
CTGAAACTGCTGCGTCTGCGGGCGCACCGCTATGCGGATAAAGCCCTGCTGAACCGAAAAATGGAAATCC
TGCTGGGAACGCTGGTGGCAATCGATCCGGTACGGGCAGCGGTATTGTGTGATACGCAACATAAGGACTG
A