SecReT6
Protein ID: 556554757
SecReT6 ID862
T6SS typei2
Gene symbol-
Locus tagP423_15530
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3171900..3172244 [+]
Producthypothetical protein
NoteTssJ
UniProt IDU5SR76
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-18, Aligned region: 19..107
Protein Sequence: 114 a.a.     [Download]
>gi|556554757|ref|YP_008723098.1| hypothetical protein P423_15530 [Escherichia coli JJ1886]
MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALNTDAEDTPLST
MVHVWQLKTREDFDKADYDTLFMQEEKTLEKNVLAKVSVNGAPY
 
Nucleotide Sequence: 345 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3171900-3172244 Escherichia coli JJ1886, complete genome
ATGTTTCCTATTCGTTTTAAACGTCCGGCGCTGCTCTGTATGGCGATGCTGACGGTTGTTCTGAGCGGCT
GCGGGCTGATTCAGAAAGTGGTGGATGAATCGAAAAGCGTGGCCTCAGCCGTTTTCTACAAGCAAATCAA
AATACTGCATCTCGATTTCTTCTCCCGAAGTGCCCTGAATACGGATGCGGAAGATACGCCGCTTTCCACG
ATGGTGCATGTCTGGCAACTGAAAACCCGCGAAGATTTTGACAAGGCGGATTATGACACCCTGTTTATGC
AGGAAGAGAAGACGCTGGAGAAGAACGTACTGGCAAAAGTAAGCGTCAACGGAGCACCGTATTGA