SecReT6
Protein ID: 556554759
SecReT6 ID862
T6SS typei2
Gene symbol-
Locus tagP423_15545
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3174799..3174975 [+]
Producthypothetical protein
NoteTssJ
UniProt IDU5STX3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.00E-08, Aligned region: 1..49
Protein Sequence: 58 a.a.     [Download]
>gi|556554759|ref|YP_008723101.1| hypothetical protein P423_15545 [Escherichia coli JJ1886]
MPLDKETQFVAIIGQFYHPDEKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
 
Nucleotide Sequence: 177 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3174799-3174975 Escherichia coli JJ1886, complete genome
GTGCCGCTGGATAAAGAGACGCAGTTTGTCGCCATTATTGGGCAGTTTTATCACCCTGATGAAAAAAGCG
ACAGCTGGCGTCTGGTGATCAAAAGGGACGAACTGGAGGCCGACAAGCCGCGCTCGATTGAACTGATGAG
AAGCGACCTGCGACTGCTGCCTCTCAAGGATAAATAA