SecReT6
Protein ID: 556554761
SecReT6 ID862
T6SS typei2
Gene symbol-
Locus tagP423_15555
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3175407..3176783 [+]
ProductimpA family protein
NoteTssA
UniProt IDU5SQU4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 8.50E-48, Aligned region: 117..127
DUF3702 [PF12486], Evalue: 8.50E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 1.10E-17, Aligned region: 42..100
Protein Sequence: 458 a.a.     [Download]
>gi|556554761|ref|YP_008723103.1| impA family protein [Escherichia coli JJ1886]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRQVEKLCLALFRQNGVELQTLVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
SAIETTLQQCELWHMTKLDVLAGQFRNTALRLERLAPQGAETTITPPELPRREMNQPKKSEESPQPVFAT
RPAQQNDKDASPPVSSPEISRQRTWPIFMAGMVVMAGLGGTGLWGWSQLNQPDALIQRIQLSVMPLPQSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNVQWRK
QRELSALSAEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEISPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3175407-3176783 Escherichia coli JJ1886, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACTTATAAGGAATCCG
GTGAACTGCAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGACCGGATGTGGACTGGCGTCAGGTGGA
AAAACTCTGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAACTACAGACGCTGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGCTCACTGGATATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGCTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATCTACCGTTGTGTACAGCATCTT
TCCGCCATCGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAACTGGATGTGCTGGCCGGGC
AGTTTCGCAATACCGCATTGCGTCTGGAACGGCTGGCGCCTCAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAATCAACCGAAAAAGTCAGAAGAAAGTCCACAGCCGGTTTTTGCAACG
AGACCCGCTCAGCAAAACGATAAGGATGCCAGTCCACCCGTGTCATCCCCTGAAATCTCCCGACAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCGGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCGCTAATCCAGCGAATACAACTGTCTGTCATGCCGTTGCCGCAGTCGCTG
GAGAGCGGCGAACTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTACCTGCCCGCTGGCCGCTGGAGCAGGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGGGCGCTGAACGTGCAGTGGCGTAAA
CAGCGGGAACTGAGCGCCCTGTCCGCAGAGGCACTGAATGGCTACGCACAGGCGCAGAGTCAGCTACAGC
GCCTGTCGGCACAACTGGATGCACTGGATGAACGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGATTTCGCCGACGCTGTTGACGCAGATTGATACCCGGTTAAATCAGTTGCTGA
ATCGCTATGTCATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA