SecReT6
Protein ID: 556571815
SecReT6 ID867
T6SS typei3
Gene symbol-
Locus tagBBK_5737
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2761922..2763637 [+]
Producttype IV/VI secretion system , DotU family domain protein
NoteTssL
UniProt IDU5V0B3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-43, Aligned region: 141..336
OmpA [PF00691], Evalue: 5.10E-10, Aligned region: 395..502
Protein Sequence: 571 a.a.     [Download]
>gi|556571815|ref|YP_008742182.1| type IV/VI secretion system , DotU family domain protein [Burkholderia pseudomallei NCTC 13179]
MSLLRNLSSTLRRVSMASNMLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPS
FAPPAADAFPQADGAPRNPAVLQFPVPGGAPAPADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSH
ALPAVLQLQRHLAAGPLNQAAIRTQLGLEVRLYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHA
QVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPLLSFYELILSLGWQGRYRVLDRGDVLLQDL
RSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGAISFWLDSQGRPIRNALAAW
MPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPW
PGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPID
TAKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYATSTTMP
ATRPTTEGRQP
 
Nucleotide Sequence: 1716 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2761922-2763637 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAGCCTGCTACGAAACCTCTCCTCCACGCTGCGCCGCGTATCGATGGCATCCAACATGCTCGATCGCG
CGGCGGCGAATCCGGATCTCGTGACGCGCGTGCCGACGCTGTCGTCGCTGTCGAGCGCGGCGATGACGAG
CTCCGCCGTATCGACCACCGGCACGACGAACACGGTGGCGTCGGGCGGCGCGGCCGCGGGCGCGCCGAGC
TTCGCGCCGCCGGCCGCCGACGCGTTTCCCCAAGCCGACGGCGCGCCCCGCAACCCCGCGGTGCTGCAAT
TCCCGGTGCCGGGCGGCGCGCCCGCGCCCGCCGACGCGCGGGTGGCCGCGCCCGTCGTCTACAGCGCGCA
GGGCGAGCAGGCCGCGATCATGAAAGCAGGCCTGCAGCAGGCGAGCTGGAACAACCCGTTCGTGTCGCAC
GCGCTGCCCGCGGTGCTGCAACTGCAGCGCCACCTCGCGGCCGGCCCGCTCAATCAGGCCGCGATCCGCA
CGCAGCTCGGCCTCGAGGTGCGGCTCTACCGCGAGCGGCTCGCCGCCTCCGGCTGCGAATGGGAGCAGAT
CCGCGACGCGTCGTACCTGCTCTGCACGTATCTCGACGAAACCGTCAACGACGCGGCGCGCGAGCACGCG
CAAGTCGTCTACGACGGCGAGCGCAGCCTGCTCGTCGAATTCCACGACGACGCGTGGGGCGGCGAGGACG
CGTTCGCCGACCTGTCGCGCTGGATGAAGACCGAGCCGCCGCCGATTCCGCTTCTGTCGTTCTACGAACT
GATCCTGTCGCTCGGCTGGCAGGGCCGCTACCGCGTGCTCGACCGCGGCGACGTGCTGCTGCAGGATCTG
CGCTCGCAACTGCACGCGCTGATCTGGCATCACGTGCCGCCCGAGCCGCTCGGCACCGAGCTCGTCGCGC
CCGCGAAGCGGCGCCGCTCGTGGTGGACGGCCGGGCGCGCGGCGGCCGTCGCGCTCGGCGTGCTGGTGCT
CGCGTACGGCGCGATCAGCTTCTGGCTCGATTCGCAGGGCCGCCCGATCCGCAACGCGCTCGCCGCGTGG
ATGCCGCCCACGCGCACGATCAACATCGCCGAGACGCTGCCGCCGCCGCTGCCGCAGATTCTCACCGAAG
GGTGGCTCACCGCGTACAAGCATCCGCAAGGATGGCTGCTCGTGTTCAAGAGCGACGGCGCGTTCGACGT
CGGCAAGGCGAACGTGCGGGCGGACTTCATGCACAACATCGAGCGGCTCGGCCTCGCGTTCGCGCCGTGG
CCGGGCGACCTCGAGGTGATCGGCCACACCGATTCGCGGCCGATCCGCACAAGCGAGTTCCCGGACAACC
AGGCGCTGTCCGAAGCGCGGGCGCGCAACGTCGCCGACGAACTGCGCAAGACCGCGCTGCCGGGCGGCGC
GCGCGCGCCGGAGAACGCGGTGCAGCGCAACATCGAGTACTCGGGGCGCGGCGACGCGCAGCCGATCGAC
ACCGCGAAGACGGCCGCCGCGTACGAGCGCAACCGCCGCGTCGACGTGCTGTGGAAGGTGATTCCCGACG
GCGCGCAGCAATCGGGCCGCAGCCTGAACCTGCAGCAGCCGGAGAAGCCCGGGCAGGTGCCGATGCGTCC
GGCGATGCCGGAGGGCGTGGAGATCGCGCCTGACGGGCAACTGCCGTATGCGACGTCAACCACGATGCCA
GCAACGCGACCGACCACGGAGGGCCGTCAGCCATGA