SecReT6
Protein ID: 556571898
SecReT6 ID867
T6SS typei3
Gene symbol-
Locus tagBBK_5727
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2747897..2749177 [+]
Productclp amino terminal domain protein
NoteTssH
UniProt IDU5UZV5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_16 [PF13191], Evalue: 3.60E-09, Aligned region: 81..82
AAA_16 [PF13191], Evalue: 3.60E-09, Aligned region: 205..250
AAA_16 [PF13191], Evalue: 3.60E-09, Aligned region: 271..306
AAA_16 [PF13191], Evalue: 3.60E-09, Aligned region: 366..388
AAA [PF00004], Evalue: 4.20E-09, Aligned region: 228..333
Clp_N [PF02861], Evalue: 3.30E-07, Aligned region: 23..72
Clp_N [PF02861], Evalue: 3.30E-07, Aligned region: 111..129
Arch_ATPase [PF01637], Evalue: 0.00069, Aligned region: 206..247
Arch_ATPase [PF01637], Evalue: 0.00069, Aligned region: 280..377
AAA_22 [PF13401], Evalue: 0.002, Aligned region: 227..337
NACHT [PF05729], Evalue: 0.0057, Aligned region: 228..256
DUF815 [PF05673], Evalue: 0.0079, Aligned region: 218..303
Protein Sequence: 426 a.a.     [Download]
>gi|556571898|ref|YP_008742172.1| clp amino terminal domain protein [Burkholderia pseudomallei NCTC 13179]
MNRERIFNCLGRTTYAALVDATALGRSRRHAFIDLDHWALCLLQREQSDLARLFELFGSDAGEAKRRMEK
ALDGFDVSGDSLRDISSSLERSVGPAVIWSQIAARAGKVRSGHLLLAWLDEDLTRRWLQQRVPSGITSVA
LDDVVKRYEALAAGWPEADEAPAALDGAALGAQAGEAGADGTGDALAKWATCVTEQAARGELDPVVGRDD
ELRTVIDILSRRRQNNPILVGEAGVGKTAVVEALAQKIHAGAVPPGLVGAQVWALDLARMQAGAGVRGEF
EQRLKSLIDAVIASPAPIILFCDETHTLIGAGGAAGTGDAANLIKPMLARGQLRMVAATTWSEYKQYIEP
DAALVRRFQAVAVDEPSDDAAVDMLRTIAPRFAAHHGVRIVDSALRGAVELSRRYLPARQLPDKAISLLD
SARAWR
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2747897-2749177 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
GTGAATCGCGAACGCATATTCAACTGTCTCGGCCGCACGACCTATGCGGCCCTTGTCGATGCGACGGCGC
TGGGCCGATCGCGTCGGCACGCCTTCATCGATCTCGATCACTGGGCGCTGTGCCTGCTGCAGCGCGAGCA
GAGCGATCTCGCGCGGCTGTTCGAGCTGTTCGGCAGCGATGCCGGCGAAGCGAAGCGCCGCATGGAGAAG
GCGCTCGACGGCTTCGACGTGAGCGGCGACTCGCTGCGCGACATCTCCAGCTCGCTGGAGCGCAGCGTGG
GGCCGGCCGTCATCTGGAGCCAGATCGCGGCGCGCGCGGGCAAGGTGCGCTCCGGCCACCTGCTGCTCGC
GTGGCTCGACGAGGATCTGACGCGCCGCTGGCTGCAGCAGCGCGTGCCGAGCGGCATCACGTCGGTGGCG
CTCGACGACGTGGTGAAGCGCTATGAGGCGCTCGCGGCGGGCTGGCCGGAAGCCGACGAGGCGCCGGCCG
CGCTGGACGGCGCGGCGCTGGGCGCGCAGGCGGGCGAAGCCGGCGCAGACGGCACGGGCGACGCGCTCGC
GAAGTGGGCGACGTGCGTGACGGAGCAGGCCGCGCGCGGCGAGCTCGATCCGGTGGTGGGGCGCGACGAC
GAATTGCGCACGGTGATCGACATTCTGTCGCGCCGCCGGCAGAACAACCCGATCCTCGTGGGCGAGGCGG
GGGTGGGCAAGACGGCCGTGGTCGAGGCGCTCGCGCAGAAGATCCACGCGGGCGCGGTGCCGCCGGGGCT
CGTGGGCGCGCAGGTGTGGGCGCTCGACCTGGCGCGGATGCAGGCGGGCGCGGGGGTGCGCGGCGAGTTC
GAGCAGCGCCTGAAATCGCTGATCGACGCGGTGATCGCCTCGCCCGCGCCGATCATCCTGTTCTGCGACG
AGACGCACACGCTGATCGGCGCGGGCGGCGCGGCGGGCACGGGCGACGCGGCCAACCTGATCAAGCCGAT
GCTCGCGCGCGGCCAATTGAGGATGGTCGCGGCGACGACGTGGTCCGAATACAAGCAGTACATCGAGCCG
GACGCGGCGCTTGTGCGGCGCTTCCAGGCGGTCGCGGTCGACGAGCCGAGCGACGATGCGGCGGTCGACA
TGCTGCGCACGATCGCGCCGCGCTTTGCCGCGCACCACGGCGTGCGCATCGTCGATTCGGCGCTGCGCGG
CGCGGTCGAGCTGTCGCGCCGCTATCTGCCCGCGCGGCAGTTGCCGGACAAGGCGATCAGCCTGCTCGAC
AGTGCGCGCGCGTGGCGATGA