SecReT6
Protein ID: 556572106
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5231
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2124642..2125331 [+]
Producthypothetical protein
NoteTssL
UniProt IDU5V418
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.20E-31, Aligned region: 8..205
Protein Sequence: 229 a.a.     [Download]
>gi|556572106|ref|YP_008741683.1| hypothetical protein BBK_5231 [Burkholderia pseudomallei NCTC 13179]
MSIEMPAQPLRMLLQDTMLHVALLTQGARISRVHDWRARCIALVRQFEQALQDGGYRGGIANELSLAQCV
FLDEITMRNLSPEQKEEWLRELLQFRFHSTRDGLSKVRARVDRLCSGHSANAALLEMYSLFHEFGLLGDK
QGHALADARVSEARPTPGKKAAETAEIWKDGGAANEAAHGRSWRIVGGLLAFAALMTMWLVIDTRLSHEV
EQMEVTSGDEAAIHPASGD
 
Nucleotide Sequence: 690 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2124642-2125331 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGTCGATTGAAATGCCCGCGCAGCCGCTGCGCATGTTATTGCAGGACACGATGCTCCATGTCGCGCTAT
TGACGCAAGGCGCGCGCATATCGCGCGTGCATGACTGGCGCGCGCGCTGCATCGCGCTCGTCAGGCAATT
CGAGCAGGCGCTGCAGGACGGCGGCTACCGCGGCGGTATTGCCAATGAATTGAGCCTCGCGCAATGCGTT
TTTCTGGACGAGATCACGATGCGCAATCTGTCGCCCGAGCAAAAGGAAGAATGGTTGCGTGAGCTCCTTC
AGTTCCGCTTCCACTCGACTCGGGATGGGTTGAGCAAAGTGCGTGCGCGTGTCGATCGCCTTTGCAGCGG
GCATTCGGCGAATGCCGCATTGCTGGAAATGTATTCGTTGTTCCATGAATTCGGTCTCCTGGGAGACAAG
CAAGGGCACGCGTTAGCCGACGCGCGGGTGTCGGAGGCAAGGCCGACGCCCGGAAAGAAAGCCGCGGAAA
CGGCGGAGATTTGGAAGGACGGGGGGGCCGCCAATGAAGCGGCGCACGGACGCTCTTGGCGAATCGTCGG
CGGCCTGCTGGCGTTTGCGGCGCTCATGACGATGTGGCTCGTTATCGACACACGTCTGAGCCATGAAGTG
GAACAGATGGAAGTCACGTCCGGAGATGAAGCAGCGATTCATCCGGCATCGGGGGATTGA