SecReT6
Protein ID: 556572202
SecReT6 ID866
T6SS typei3
Gene symbol-
Locus tagBBK_5369
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2294817..2295398 [+]
Productlysozyme family protein
NoteTssE
UniProt IDU5V4C8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-18, Aligned region: 60..170
Protein Sequence: 193 a.a.     [Download]
>gi|556572202|ref|YP_008741821.1| lysozyme family protein [Burkholderia pseudomallei NCTC 13179]
MDAHETRADAPRNGDEACVRGEGLATPRRANTQLLPTLIDRLRDDAPQRQTEAPGEYALTRMQMRGIVQR
DLAFLLNTTSIDEHIDRERHPAAAASTLNFGVPPLAGAFLASCQWAEVERIIRRVILDFEPRLIAETLVV
APSRAAGAVARPNVLAFEVRGMIRMDPYPIEFMVQSALDLETNQVNITGMRAS
 
Nucleotide Sequence: 582 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2294817-2295398 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGGATGCGCATGAGACGCGCGCGGACGCGCCGCGCAACGGCGACGAGGCGTGCGTGCGCGGCGAAGGCC
TCGCGACGCCGCGCCGCGCGAACACGCAGCTGCTGCCGACGCTGATCGACCGCCTGCGCGACGACGCGCC
GCAACGGCAGACCGAAGCGCCCGGCGAATATGCGCTCACGCGCATGCAGATGCGCGGCATCGTCCAGCGT
GATCTCGCCTTCCTGCTCAACACGACGAGCATCGACGAGCACATCGATCGCGAACGCCATCCGGCCGCCG
CCGCCTCGACGCTCAACTTCGGCGTGCCGCCGCTTGCCGGCGCGTTTCTCGCGTCGTGCCAGTGGGCCGA
GGTCGAACGCATCATCCGCCGCGTGATTCTCGATTTCGAGCCGCGGCTGATCGCCGAGACGCTCGTCGTC
GCGCCGTCGCGGGCCGCCGGCGCGGTCGCGCGCCCGAACGTGCTCGCGTTCGAGGTGCGCGGCATGATTC
GTATGGATCCCTATCCGATCGAATTCATGGTGCAAAGCGCGCTCGATCTCGAAACGAACCAGGTCAACAT
CACCGGCATGCGCGCGAGCTGA