SecReT6
Protein ID: 556572228
SecReT6 ID866
T6SS typei3
Gene symbol-
Locus tagBBK_5362
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2286314..2286817 [-]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDU5V0V4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-40, Aligned region: 14..160
Protein Sequence: 167 a.a.     [Download]
>gi|556572228|ref|YP_008741814.1| type VI secretion lipofamily protein [Burkholderia pseudomallei NCTC 13179]
MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYELKTDGAFNAAD
FFTLQGPDKTVLADDLLARERFQLRPGEHRVIRRDADPAAGALGVVAAYRDLPNSVWRAAYPLPPARDAA
WYRFSSPKLKLTIELDTHAIRITEPGK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c2286817-2286314 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGCACCCGACCACCCCCGTTGCCGCCGTCGCGCTCGCGCTCGCGTGCGCCGCGTGCGCGAGCGGCGCGG
CCAAGCAGAAGGAGCCGCTGCGGCTCGAGCTCGCCGTGCGCGCCGCGCCCACGGTCAATCCGGACGATCG
GAGCCGGCCGGCTCCGATCGTCGTGAGCGTCTACGAGCTGAAGACCGACGGCGCATTCAACGCCGCCGAT
TTCTTCACGCTGCAGGGCCCGGACAAGACCGTGCTCGCCGACGATCTGCTCGCGCGCGAGCGTTTTCAAC
TGCGCCCCGGCGAGCACCGCGTGATCCGGCGCGACGCCGATCCGGCGGCGGGCGCGCTCGGCGTCGTCGC
CGCGTACCGCGATCTGCCGAACTCGGTGTGGCGCGCGGCATATCCGCTGCCGCCCGCGCGGGACGCCGCA
TGGTATCGCTTCTCGTCGCCGAAGCTGAAGCTGACCATCGAGCTCGACACGCACGCGATCAGGATCACCG
AACCCGGAAAATGA